Fast Heuristic Local Alignment Algorithms: Stephen F
Fast Heuristic Local Alignment Algorithms: Stephen F
Stephen F. Altschul
National Center for Biotechnology Information National Library of Medicine National Institutes of Health
The Problem
The Smith-Waterman algorithm is slower than desirable for database searches. The SW algorithm spends a lot of time on sequences, and regions of the path graph, that contain no biologically relevant alignments.
There are very fast algorithms for finding perfect matches But many interesting alignments are very weak. Biologically relevant protein alignments may contain no runs of more than two identical letters.
Central ideas:
A local alignment with score high enough to be of interest (i.e. to be statistically significant) likely will contain an aligned pair of short words with score greater than or equal to some threshold value . We call such a aligned pair of words a hit. To seek significant local alignments (called high-scoring segment pairs, or HSPs), BLAST first seeks hits, and then investigates whether each hit is a chance event, or is contained in an HSP. For each word in the query sequence, BLAST determines what possible words it could pair with to form a hit. BLAST builds these words into a table, and scans the database for exact matches, each of which constitutes a hit. Altschul, S.F., et al. (1990) Basic local alignment search tool. J. Mol. Biol. 215:403-410.
neighborhood words
Query: a Subject:
Finding Hits
As one steps through database sequences, each word may correspond to one or more hits involving words from the query. There are various ways to locate these hits. Array of lists. Each word can serve as a pointer into an array of lists. The array has size , where is the size of the alphabet. If many fewer than neighborhood words are generated by the query, the size of the array may be reduced by hashing. Finite state machine. One may construct a finite state machine to recognize hits. This is generally faster than the list method, but is more complicated.
Mealy, G.H. (1955) A method for synthesizing sequential circuits. Bell System Tech. J. 34:1045-1079.
25
15 60 45
17
---XXXXXXXXXXX---
Hits:
13 11
Karlin, S. & Altschul, S.F. (1993) Applications and statistics for multiple high-scoring segments in molecular sequences. Proc. Natl. Acad. Sci. USA 90:5873-5877.
Gapped BLAST
Outline of the gapped BLAST strategy:
1) Invoke a gapped extension whenever an ungapped HSPs score reaches a threshold . Because gapped extensions are very costly, choose so that only about 2% of unrelated database sequences trigger a gapped extension. 2) Seed the gapped extension from the highest-scoring region of the triggering HSP. 3) Generalize the X-drop procedure to the Smith-Waterman algorithm.
Altschul, S.F. et al. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25:3389-3402.
Figure from: Altschul, S.F. et al. (1997) Nucleic Acids Res. 25:3389-3402.
43 FSFLKDSAGVVDSPKLGAHAEKVFGMVRDSAVQLRATGEVV-LDGKDGS------ 90 F L + V+ +PK+ AH +KV L + GE V LD G+ 45 FGDLSNPGAVMGNPKVKAHGKKV----------LHSFGEGVHHLDNLKGTFAALSE 90 91 IHIQKGVLDP-HFVVVKEALLKTIKEASGDKWSEELSAAWEVAYDGLATAI 140 +H K +DP +F ++ L+ + G ++ EL A+++ G+A A+ 91 LHCDKLHVDPENFRLLGNVLVVVLARHFGKGFTPELQASYQKVVAGVANAL 141
Figures from: Altschul, S.F. et al. (1997) Nucleic Acids Res. 25:3389-3402.
Figure from: Altschul, S.F. et al. (1997) Nucleic Acids Res. 25:3389-3402.
Figure from: Altschul, S.F. et al. (1997) Nucleic Acids Res. 25:3389-3402.
Relative times spent by the original and gapped BLAST programs on various algorithmic stages
Overhead: database scanning, output, etc. Calculating whether hits qualify for ungapped extension
Ungapped extensions
Gapped extensions
Total
Table from: Altschul, S.F. et al. (1997) Nucleic Acids Res. 25:3389-3402.
Varieties of BLAST
The BLAST programs are available on the NCBI web site: http://blast.ncbi.nlm.nih.gov/
Different applications call for different versions of the program: blastn: Search a nucleotide database using a nucleotide query blastp: Search a protein database using a protein query blastx: Search a protein database using a translated nucleotide query
Used to look for exons in cDNA sequences.
Indexed BLAST
When a large DNA database, such as a completed genome, is fixed, and will be searched many times, one can index the database, and devote a machine to keeping the index in memory. A query sequence can then simply look up hits in this index. This basically reverses the roles of the query and database.
BLAT
Kent, W.J. (2002) BLAT--The BLAST-Like Alignment Tool. Genome Res. 12: 656-664.