Alzheimer's Disease
Alzheimer's Disease
Edited by
George Perry
Case Western Reserve University, USA
Jess Avila
Universidad Autnoma de Madrid, Spain
June Kinoshita
Alzheimer Research Forum, USA
and
Mark A. Smith
Case Western Reserve University, USA
LEGAL NOTICE
The publisher is not responsible for the use which might be made of the following information.
PRINTED IN THE NETHERLANDS
Contents
List of contributors
Preface, Alzheimer's disease: A century of scientific and clinical research
George Perry, Jess Avila, June Kinoshita and Mark A. Smith
Historical Perspective
Progress in the history of Alzheimers disease: The importance of context
Jesse F. Ballenger
100 Years of Alzheimers disease (1906-2006)
Jos Manuel Martnez Lage
15
Neuropathology
The essential lesion of Alzheimer disease: A surprise in retrospect
Melvyn Ball
29
35
45
53
61
71
Synaptic Changes
Vulnerability to Alzheimers pathology in neocortex: The roles of plasticity and columnar organization 79
Margaret Esiri and S.A. Chance
Synaptic remodeling during aging and in Alzheimers disease
Eliezer Masliah, Leslie Crews and Lawrence Hansen
91
101
117
Amyloid
Molecular basis of memory loss in the Tg2576 mouse model of Alzheimer disease
Karen Ashe
123
127
133
151
155
163
Tau
Tau protein, the main component of paired helical filaments
Jess Avila
171
177
187
195
209
219
243
251
Progress from Alzheimers tangles to pathological tau points towards more effective therapies now
Virginia M.-Y. Lee and John Q. Trojanowski
257
Disease Mechanisms
A long trek down the pathways of cell death in Alzheimers disease
Peter Davies
265
271
277
291
301
Oxidative stress and iron imbalance in Alzheimer disease: How rust became the fuss!
Mark A. Smith
305
309
319
Genetics
Studies on the first described Alzheimers disease amyloid E mutant, the Dutch variant
Efrat Levy, Frances Prell and Blas Frangione
Segregation of a missense mutation in the amyloid E-protein precursor gene with familial
Alzheimers disease
Alison Goate
The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene. My story.
Dmitry Goldgaber
On the discovery of the genetic association of Apolipoprotein E genotypes and common late-onset
Alzheimer disease
Allen Roses
Early Alzheimers disease genetics
Gerard Schellenberg
Mutations in the tau gene (MAPT) in FTDP-17: The family with Multiple System Tauopathy with
presenile Dementia (MSTD)
Maria Grazia Spillantini, Jill R. Murrell, Michel Goedert, Martin Farlow, Aaron Klug
and Bernardino Ghetti
Genetic complexity of Alzheimers disease: Successes and challenges
Ekaterina Rogaeva,, Toshitaka Kawarai and Peter St George-Hyslop
Genetics and pathology of alpha-secretase site AEPP mutations in understanding of
Alzheimers disease
C. van Broeckhoven and Samir Kumar-Singh
329
341
349
361
367
373
381
389
401
409
Consensus guidelines for the clinical and pathologic diagnosis of dementia with Lewy bodies (DLB):
Report of the consortium on DLB international workshop
417
Ian McKeith
Immunotherapy for Alzheimers disease
David Morgan
425
Alzheimers disease immunotherapy: From in vitro amyloid immunomodulation to in vivo vaccination 433
Beka Solomon
Tacrine, and Alzheimers treatments
William Summers
439
Quality of Life: The bridge from the cholinergic basal forebrain to cognitive science and bioethics
Peter Whitehouse
447
Subject index
455
Contributors Index
Ashe, K.H., University of Minnesota, USA and Minneapolis Veterans Affairs, Medical Center, USA
123
1, 171
401
29
155
35
177
133
277
79
91
195
265
35
187
79
373
319
329
127
133
45, 373
341
195, 373
349
Grundke-Iqbal, I., New York State Institute for Basic Research in Developmental Disabilities, USA
219
91
151
53
319
401
209
53
Iqbal, K., New York State Institute for Basic Research in Developmental Disabilities, USA
219
61
243
381
Khachaturian, Z.S., Khachaturian, Radebaugh & Associates (KRA), Inc., Potomac, USA
409
71
195, 373
133
251
389
15
257
329
91
Masters, C.L., The University of Melbourne and the Mental Health Research Institute of Victoria, Australia 155
McGeer, E.G., University of British Columbia, Canada
271
271
417
291
425
373
277
291
1, 301
329
101
381
271
361
35
101
367
133
35
Selkoe, D.J., Brigham and Womens Hospital and Harvard Medical School, USA
163
133
401
1, 305
433
373
381
439
127
309
117
257
389
Van Leeuwen, F.W., Netherlands Institute for Brain Research, The Netherlands
319
447
Preface
The centennial of Alois Alzheimers original description of the disease that would come to bear his
name offers a vantage point from which to commemorate the seminal discoveries in the field. To identify
the breakthroughs, we used citation analysis, milestone
papers identified by current researchers, and our own
suggestions. Our process took into account the perspectives of individuals who recall the impact of findings at the time they were made, as well as of scientists
today who have the advantage of hindsight in weighing
the lasting influence of these findings. Because modern
Alzheimer disease research was triggered by the seminal work of Tomlinson, Blessed, and Roth some four
decades ago, we are especially fortunate that the vast
majority of these milestone authors are still with us.
Each contributor was invited to discuss what made
their particular article a milestone in the context of its
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
Historical Perspective
1. Introduction
Without a doubt, the history of Alzheimers disease
(AD) is a history of progress. As it is usually formulated, progress in medicine means the history of great
doctors and scientists in the past making great discoveries that are in turn taken up by great doctors and scientists in the present all sharing the aim of unraveling
the mysteries of disease and discovering how it can be
prevented or cured. In this way of looking at the history of science and medicine, the research of previous
generations is noticed only to the degree to which it
anticipated or contributed to current concepts and research initiatives. In the case of AD, this produces a
historical narrative that begins with Alzheimers first
description in 1906 and Kraepelins naming of the dis-
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
J.F. Ballenger / Progress in the history of Alzheimers disease: The importance of context
J.F. Ballenger / Progress in the history of Alzheimers disease: The importance of context
J.F. Ballenger / Progress in the history of Alzheimers disease: The importance of context
were well aware of, and puzzled by, their similarity [24,
25]. But beginning in the 1930s, a different orientation
towards dementia in psychiatry and the emergence of
social gerontology would challenge these assumptions,
setting the context for the emergence of the current
understanding of AD in the late 1970s.
American psychiatrists began to increasingly move toward office-based practice in the community. In 1965,
provisions in the Medicare and Medicaid legislation
made the federal government responsible for funding
nursing-home care of the elderly, resulting in the shift
of many thousands of elderly patients out of the mental
hospitals and into nursing homes and various community care arrangements [18].
In the mid-1930s, American psychiatrists, led by
David Rothschild of the Worcester State Hospital, developed a new theory of dementia that seemed to answer both sets of problems. The new concept of dementia emphasized psychosocial factors over brain pathology in the etiology of dementia thus bringing the
age-associated dementias into mainstream psychiatry.
The basis of this re-conceptualization was an inability
to establish a definitive correlation between dementia
and brain pathology, as reported by Gellerstedt and by
Rothschild himself [15,42,43,45]. Rothschild and his
followers argued that the lack of correlation between
clinical and pathological data could best be accounted
for by a differing ability among individuals to compensate for organic lesions. Seen this way, age-associated
dementia was more than the simple and inevitable outcome of a brain that was deteriorating due to disease
and/or aging. Rather, dementia was a dialectical process between the brain and the psychosocial context
in which the aging person was situated. Factors such
as pre-morbid personality structure, emotional trauma,
disruptions of family support and social isolation were
regarded as at least as important in explaining dementia
as the biological processes within the brain that produced plaques and tangles [4].
For psycho dynamically oriented American psychiatrists, the psychodynamic approach was a more satisfying theory of dementia, and provided a logical basis
for making meaningful therapeutic interventions. Thus
it is no surprise that there was a surge of interest in ageassociated dementias within American psychiatry during this period. In the 10 years from 19261935, there
had only been nine articles concerning senile dementia
and/or AD published in the American Journal of Psychiatry and the Archives of Neurology and Psychiatry,
the two leading professional journals; in the following
decade, 36 articles appeared. Much of this literature
concerned the use of therapies that had previously been
considered inappropriate for aged patients including
psychotherapy, ECT, hormones, vitamins, and other
drug treatments. From 1935 to 1959, thirty-five articles reporting on the use of therapies including group
psychotherapy, hormone treatments, appeared in these
J.F. Ballenger / Progress in the history of Alzheimers disease: The importance of context
10
J.F. Ballenger / Progress in the history of Alzheimers disease: The importance of context
p. 3] The solution was a program to provide older people with meaningful activities to fill the remainder of
their lives.
Broadly construed, this was the program of social
gerontology for reconstructing old age. And whatever
the scientific merits of this model of the social production of senility as an account of the pathogenesis of
dementia, those who embraced it were generally successful in winning a series of significant policy changes
that helped to transform the experience of aging in
America. By the 1970s, much of this program had in
fact been accomplished. The material circumstances of
old age had been markedly improved, though not to an
equal extent for all older people; significant legal protections had been won against age discrimination; negative stereotypes in popular and professional discourse
were increasingly challenged, and, perhaps most importantly, the elderly themselves organized for effective
political advocacy an action on their own behalf [10,
20]. In this context, the problem of age-associated
dementia became more visible and tragic. As noted
above, after 1965 deinstitutionalization increased the
burden that dementia posed to communities and families, while heightened expectations for old age made
senile dementia an even more devastating prospect [5].
J.F. Ballenger / Progress in the history of Alzheimers disease: The importance of context
11
[4]
[5]
[6]
12
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
J.F. Ballenger / Progress in the history of Alzheimers disease: The importance of context
G.E. Berrios, Alzheimers Disease: A Conceptual History,
International Journal of Geriatric Psychiatry 5 (1990), 355
365.
K.L. Bick, L. Amaducci et al., The early story of Alzheimers
disease: translation of the historical papers by Alois
Alzheimer, Oskar Fischer, Francesco Bonfiglio, Emil Kraepelin, Gaetano Perusini, Padova, Liviana Press, 1987.
R.N. Butler, Why survive? Being old in America, New York,
Harper & Row, 1975.
R.B. Calhoun, In search of the new old; redefining old age in
America, 19451970. New York, Elsevier, 1978.
W.T. Donahue, C. Tibbitts et al., Planning the older years,
Ann Arbor, University of Michigan Press, 1950.
E.J. Engstrom, Clinical psychiatry in imperial Germany: a
history of psychiatric practice, Ithaca, Cornell University
Press, 2003.
P. Fox, From senility to Alzheimers disease: the rise of the
Alzheimers disease movement, Milbank Q 67(1) (1989), 58
102.
E.A. Friedmann and R.J. Havighurst, The meaning of work
and retirement, [Chicago], University of Chicago Press, 1954.
N. Gellerstedt, Zur Kenntnis der Hirnveranderungen bei der
normalen Altersinvolution, Upsala Lakareforenings Forhandlingar 38 (1933), 193408.
G.N. Grob, Mental illness and American society, 18751940,
Princeton, N.J., Princeton University Press, 1983.
G.N. Grob, Explaining Old Age History: The Need for Empiricism, in: Old Age in a Bureaucratic Society, D.D. Van
Tassel and P.N. Stearns, New York, Greenwood Press, 1986.
G.N. Grob, From asylum to community: mental health policy in modern America, Princeton, N.J., Princeton University
Press, 1991.
C. Haber, Beyond sixty-five: the dilemma of old age in Americas past, Cambridge, Cambridge University Press, 1983.
C. Haber and B. Gratton, Old age and the search for security:
an American social history, Bloomington, Indiana University
Press, 1994.
R.J. Havighurst, Social and Psychological Needs of the Aging, Annals of the American Academy of Political and Social
Science 279 (1952), 1117.
R.J. Havighurst and R.E. Albrecht, Older people, New York,
Longmans, Green, 1953.
H.C. Hendrie, M.S. Albert et al., NIH Cognitve and Emotional Health Project: Report of the Critical Evaluation Study
Committee, Alzheimers and Dementia 2 (2006), 1232.
M. Holstein, Alzheimers disease and senile dementia, 1885
1920: An interpretive history of disease negotiation, Journal
of Aging Studies 11(1) (1997), 113.
M. Holstein, Aging, Culture, and the Framing of Alzheimer
Disease, in: Concepts of Alzheimer Disease: Biological, Clinical and Cultural Perspectives, P.J. Whitehouse, K. Maurer
and J.F. Ballenger, Baltimore, Johns Hopkins University Press,
2000.
J. Kaplan, A social program for older people, Minneapolis,
University of Minnesota Press, 1953.
S. Katz, Disciplining old age: the formation of gerontological
knowledge, Charlottesville, University Press of Virginia, 1996.
R. Katzman, Editorial: The prevalence and malignancy of
Alzheimer disease. A major killer, Arch Neurol 33(4) (1976),
217218.
R. Katzman and K.L. Bick, The Rediscovery of Alzheimer
Disease During the 1960s and 1970s, in: Concepts of
Alzheimer Disease: Biological, Clinical and Cultural Per-
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
spectives, P. Whitehouse, K. Maurer and J.F. Ballenger, Baltimore, Johns Hopkins University Press, 2000.
R. Katzman, R.D. Terry et al., Alzheimers disease: senile
dementia and related disorders, New York, Raven Press, 1978.
T. Kitwood, Explaining Senile Dementia: The Limits of Neuropathological Research, Free Associations 10 (1987), 117
138.
M. Linden and D. Courtney, American Journal of Psychiatry,
109: 906 915, 1953 (1953), The Human Life Cycle and its
Interruptions: A Psychologic Hypothesis, Am J Psychiatry
109 (1987), 906915.
K. Maurer and U. Maurer, Alzheimer: the life of a physician
and the career of a disease, New York, Columbia University
Press, 2003.
K. Maurer, S. Volk et al., Augusta D.: The History of Alois
Alzheimers First Case, Concepts of Alzheimer Disease: Biological, Clinical and Cultural Perspectives, P.J. Whitehouse,
K. Maurer and J.F. Ballenger, Baltimore, Johns Hopkins University Press, 2000.
T. Myfanwy and M. Isaac, Alois Alzheimer: A Memoir,
Trends in Neuroscience 10 (1987), 306307.
National Institute on Aging, C. T. F. Senility reconsidered.
Treatment possibilities for mental impairment in the elderly.
Task force sponsored by the National Institute on Aging, Jama
244(3) (1980), 259263.
M. Neumann and R. Cohn, Incidence of Alzheimers Disease
in a Large Mental Hospital: Relation to Senile Psychosis and
Psychosis with Cerebra; Arteriosclerosis, Archives of Neurology and Psychiatry 69 (1953), 615636.
R.D. Newton, The Identity of Alzheimers Disease and Senile Dementia and Their Relationship to Senility, Journal of
Mental Science 94 (1948), 225249.
O. Pollak and G. Heathers, Social adjustment in old age; a
research planning report, New York, Social Science Research
Council, 1948.
C.E. Rosenberg, The Crisis in Psychiatric Legitimacy: Reflections on Psychiatry, Medicine, and Public Policy, Exploring
Epidemics and Other Essays in the History of Medicine, New
York, Cambridge University Press, 1992.
M. Roth, B.E. Tomlinson et al., Correlation between scores for
dementia and counts of senile plaques in cerebral grey matter
of elderly subjects, Nature 209(18) (1966), 109110.
D. Rothschild, Alzheimers Disease: A Clinicopathologic
Study of Five Cases, American Journal of Psychiatry 91
(1934), 485519.
D. Rothschild, Pathologic Changes in Senile Psychoses and
Their Psychobiologic Significance, American Journal of Psychiatry 93 (1937), 757787.
D. Rothschild, The Practical Value of Research in the Psychoses of Later Life, 8: 123, 1947, 125, Diseases of the Nervous System 8 (1947), 123128.
D. Rothschild and J. Kasanin, Clinicopathologic Study of
Alzheimers Disease: Relationship to Senile Conditions,
Archives of Neurology and Psychiatry 36 (1936), 293321.
E. Shorter, A history of psychiatry: from the era of the asylum
to the age of Prozac, New York, John Wiley & Sons, 1997.
C. Tibbitts and W.T. Donahue, Aging in todays society, Englewood Cliffs, N.J., Prentice-Hall, 1960.
B.E. Tomlinson, G. Blessed et al., Observations on the brains
of non-demented old people, J Neurol Sci 7(2) (1968), 331
356.
B.E. Tomlinson, G. Blessed et al., Observations on the brains
of demented old people, J Neurol Sci 11(3) (1970), 205242.
J.F. Ballenger / Progress in the history of Alzheimers disease: The importance of context
[50]
R.M. Torack, Adult dementia: history, biopsy, pathology, Neurosurgery 4(5) (1979), 434342.
[51] P.J. Whitehouse, The end of Alzheimer disease, Alzheimer Dis
Assoc Disord 15(2) (2001), 5962.
[52] P.J. Whitehouse, K. Maurer et al., Concepts of Alzheimer dis-
13
ease: biological, clinical, and cultural perspectives, Baltimore, Johns Hopkins University Press, 2000.
[53] D.C. Wilson, 111: 902, 1955, The Pathology of Senility, Am
J Psychiatry 111 (1955), 902906.
15
1. Introduction
It is a curious irony that the professional and popular discourses surrounding Alzheimers disease (AD)
proceed with little awareness of its past, as Whitehouse
et al. mention in the preface to an excellent collection of essays [35]. It is my hope, in writing this article commemorative of the centennial of AD crucial
discovery, to contribute to a global understanding and
a much needed assessment of this irony. My idea is
not simply to preserve the past for its own sake, but
to better understand where we are and where we may
be going. As quoted by Bick [5], Thomas Carlyle, at
the beginning of 19th century, pondered the symbiosis between the search for knowledge and knowledge
of history. He went on to invoke reasoning and belief
as equally essential as action and passion. The reader
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
16
a doctor. In the autumn of that same year, he commenced his medical studies at the University of Berlin,
at that time the epicentre of medical science. In 1884,
he transferred to the University of W u rzburg, where he
was an active participant in student life. There, in the
lab of Kolliker, he learned the histological techniques
and use of the microscope that would be key in his future career. He studied at the University of Tubinga in
18861887, but later returned to W u rzburg to continue
perfecting his work with the microscope. He graduated
in May 1888, and completed his doctoral thesis at the
same university over the following months, studying
the wax-producing glands of the ear.
In December 1888, Alzheimer applied for a position
as a resident at the The Municipal Asylum for the Insane
and Epileptic in Frankfurt am Main and although still
very young, was awarded a place by Professor Emil
Sioli, Director of the Asylum, on the strength of his
outstanding academic achievements. Just a few months
after starting work in Frankfurt, Franz Nissl, discoverer
of the new nerve staining technique that bears his name,
joined the hospital staff. Alzheimer and Nissl took
to each other immediately and became close friends
and collaborators. Together with Sioli, they formed a
triumvirate that transformed the asylum into a sound
Psychiatric Clinic where two primary concerns were
foremost: firstly, to avoid the use of physical restraint
to reduce patient agitation; and secondly, to promote
research by doing as many autopsies and neurological
studies as possible.
Alois Alzheimer published significant studies on a
variety of neuro-psychiatric topics, including vascular
dementia and neurosphyillis. His professional prestige
continued to grow, and his colleagues nicknamed him
the psychiatrist with the microscope, for the way he
focused his work. By day he examined his patients with
painstaking care and tenderness, and by night he sat at
his microscope to study the samples he had prepared.
He was convinced that mental disorders were actually
diseases of the brain, a view that was in sharp contrast to the prevailing freudian psychoanalytical theory
of the times, which traced psychological problems to
traumatic childhood experiences.
His marriage to Cecilie Geisenheimer, the rich
widow of a banker, in 1895, gave him enough money
to support himself working as an assistant professor
without a salary. The couple had three children before
she died in 1901.
Alzheimer, an obsessed doctor and scientist, continued to reap triumph after triumph. In 1902, he
left Frankfurt and moved to Heidelberg to do research
17
18
numerous in the upper layers, one finds millet seedsize lesions, which are characterized by the deposit of
a peculiar substance in the cerebral cortex. The glia
have formed substantial threads, and alongside them,
many glial cells show large fatty deposits. Taken as
a whole, I believe I have just presented a clearly defined and hitherto unrecognised disorder. There were
no comments from the audience. Alzheimer had to be
disappointed. Did his colleagues not understand? [21].
3.4. Publication of the case
Alzheimer published the Augustes observation in
1907 [1]. He described his findings of neurofibrillary
degeneration. Use of the Bielschowsky silver stain
clearly showed characteristic changes in the neurofibrils. The nucleus disappeared and only a tangled bundle
remained in the cytoplasm where there once had been
a neuron. The transformation of the fibrils was accompanied by the storage of a pathological by-product of
neuron metabolism. These alterations appeared in one
third or one fourth of the neurons in the cerebral cortex.
Many of the neurons had disappeared completely.
He then went on to describe the plaques. A profusion
of milliary foci in the cortex showed the areas where
the abnormal substance was deposited in abundant dispersion throughout the entire cortex, particularly in the
upper layers. These were located outside the neurons
and were recognisable even without staining, although
their presence was even more evident after staining.
Alzheimer ended his observations by remarking, As
a whole, it is clear that this disorder which, over
the course of five years, caused profound dementia
in a young adult, represents an entirely new clinicopathological entity [21].
3.5. Alzheimers findings confirmed ninety years later
For some time it was speculated that Augustes disorder could be of a vascular nature, given that the autopsy
report indicated atherosclerotic changes; some even
maintained that it could possibly have been a leukodystrophy. Thus, the tissue slides taken from Auguste herself were sought out with great interest. Fortunately,
they were found at the Institute of Neuropathology of
the University of Munich in 1997 [VI] and do not contain any data that indicates the presence of ischemic
or other types of lesions. As Alzheimer had shown 91
years earlier, the slides totally corroborated the existence of abundant neurofibrillary tangles and a profusion of amyloid plaques, particularly in the upper lay-
19
4. The Eponym
There were various hypotheses regarding the origin of the eponym. The most likely of these is that
the eponym was born in the close collaboration between Kraepelin and Alzheimer, as well as in Kraepelins awareness of the pre-senile cases published by
Alzheimer in 1907 and by Perusini in 1909 [22].
When Kraepelin began his revision of Chapter 8 of
the eighth edition of his Treatise on Psychiatry published in 1910 entitled Dementia at the Degenerative
Age, he was already familiar with the publications
mentioned above and the clinical observations on the
four other patients, similar to Auguste, then studied
in Munich. A new version of this highly-demanded
book was urgently needed, and the rapid growth of the
psychiatric sciences now made a second volume necessary. The first of these reached the bookshops in
February 1909. The second, devoted to Clinical Psychiatry and the most important of the two, appeared
in July 1910. In it Kraepelins gratitude to Alzheimer
was expressed in Chapter 7, entitled Pre-senile and
senile dementia. There, in the table of contents is the
name Alzheimers Disease [20]. On page 624 Kraepelin wrote: Alzheimer described a group of cases
that showed severe neuronal alterations Interestingly
enough, when Alzheimer published his article on a second patient, Johann F., in 1911, he made no reference
to the fact that the disease had been baptised by Kraepelin with his surname. Alzheimers disease (AD).
According to Berrios [3], Alzheimer did not claim to
have discovered the disease that became named after
him.
20
of premature cerebral senility, and it was generally assumed that senile dementia was a different disorder.
By 1912 only 13 cases had been written up. The patients were an average of 50 years-old, the mean duration of the illness was seven years, six patients were
male and seven were female [5]. From 1907 until the
1950s, AD went practically unnoticed.
At that time, autopsy studies in search of new cases
of AD were only done on patients under 65 with presenile dementia. In addition to the fact that very few
people lived longer at that time (the average life expectancy was almost half what it is today), the purpose
of the studies was to confirm whether the findings of the
Munich school were actually sound. However, staining techniques gradually improved and microscopes attained greater optical capacity. Thus, over time, more
and more cases of AD were discovered, but always in
non-senile patients. Nonetheless, by 1931, the debate
regarding the relationship linking AD, senility and normal aging was already underway [10], even into the
1950s it was not easy to understand the intellectual disarray about late-life cognitive changes. There was a
failure to establish a clear clinopathological relationship between intellectual impairment and either brain
weight or abundance of plaques and tangles [16].
5.1. Cognitive decline in the elderly and AD
pathology The first prospective study:
Newcastle
The turn in the tide of opinion, which demonstrated
the true importance of AD as the major cause of late life
dementia, arose throughout the 1960s. Martin Roth,
a professor of psychiatry in Newcastle upon Tyne, designed a study that was decisive in revealing that this
disease was actually the greatest and most frequent
cause of in senile dementia [11]. A neuropsychological
test was developed to measure the mental status (memory, concentration, orientation, etc.) of elderly patients
without symptoms of dementia admitted to general hospitals for a variety of reasons, and of other elderly patients in psychiatric hospitals with overt signs of dementia. Garry Blessed developed and administered the
test to the two patient groups and later had access to
the autopsy reports on both groups of subjects. Pathologist Bernard Tomlinson created a scale for the quantitative assessment of the lesions inherent to AD. In their
study published in 1968, the British authors firmly established that neuritic plaques and neurofibrillary tangles were the main cause of what was then known as
senile dementia [6]. In a study of all the brains, includ-
21
22
amyloid peptide. Years later, Glenner told a journalist from a San Diego newspaper that President Reagan
had looked him in the eye and asked him: What is
Alzheimers disease? Glenner explained that it was
caused by the formation of neuritic plaques and neurofibrillary tangles in the cerebral cortex, causing the
death of numerous neurons, the clinical result of which
is dementia, behavior disorders and functional incapacity. Reagan smiled and said: All I know is that my
mother was very elderly and living in an old peoples
home when she died, and at the last she didnt even
recognize me [31]. His official biographer, Edmund
Morris, confirms that Nelle Reagan suffered dementia
at her death, most probably due to AD.
In 1993, Reagan underwent a full medical examination at the Mayo Clinic in Rochester, Minnesota and
was diagnosed as suffering from AD. On 5 November 1994, he published a famous, hand-written letter
in which he informed his fellow citizens that he was
just one more of the millions of Americans suffering
from Alzheimers. Upon learning this news, Nancy and
I had to decide whether as private citizens we would
keep this a private matter or whether we would make
this news known in a public way. [. . .] So now, we
feel it is important to share it with you. In opening our
hearts, we hope this might promote greater awareness
of this condition. Perhaps it will encourage a clearer
understanding of the individuals and families who are
affected by it. The letter did society a great service.
Reagan commenced the journey that led him, in his
own words, to the sunset of his life, but not without
first, in 1995, establishing the Ronald and Nancy Reagan Research Institute within the Alzheimers Association. Reagan died in 2004, 10 years after the he was
diagnosed with the disease.
23
24
25
26
[16]
References
[18]
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
A. Alzheimer, Uber
einen eigenartigc Erkrankung der Hirnrinde, Allgemeine Zeitschrift fur Psyciatrie und PsychischGerichtliche Medizin 64 (1907), 146148.
J.F. Ballenger, Beyond the characteristic plaques and tangles.
Mid-twentieth century US Psychiatry and the fight against senility, in: Concepts of Alzheimers Disease, Biological, clinical, and cultural perspectives, P.J. Whitehouse, K. Maurer and
M.A. Ballenger, eds, Baltimore, Johns Hopkins University
Press, 2000, 83-83-103.
G.E. Berrios, Dementia: historical overview, in: Dementia,
(Second edition), J. OBrien, D. Ames and A. Burns, eds,
London, Arnold, 2000, pp. 313.
K. Bick, Interview with Robert Katzman, in: Alzheimer disease, The changing view, R. Katzman and K. Bick, eds, San
Diego, Academic Press, 2000, pp. 252271.
K.L. Bick, The early story of Alzheimer disease, in: Alzheimer
Disease, R.D. Terry, R. Katzman and K.L. Bick, eds, New
York, Raven Press, 1994, pp. 18.
G. Blessed, B.E. Tomlinson and M. Roth, The association between quantitative measures of dementia and of senile changes
in the cerebral matter of elderly subjects, Br J Psychiat 114
(1968), 797811.
H. Braak and E. Braak, Neurofibrillary changes. The hallmark of Alzheimer disease, in: Concepts of Alzheimers Disease, Biological, clinical, and cultural perspectives, P.J. Whitehouse, K. Maurer and M.A. Ballenger, eds, Baltimore, Johns
Hopkins, 2000, pp. 5377.
E. Bufill and R. Blesa, Alzheimers diseqase and brain evolution: Is Alzheimjers disease an example of antagonistic
pleiotropiy? Rev Neurol 42 (2006), 2533.
M.B. Graeber, S. Kosel, E. Grasbon-Frodl, H. Moller and
P. Mehraein, Histopathology and APOE genotype of the
first Alzheimers disease patient Auguste D, Neurogenetics 1
(1998), 223228.
R. Katzman and K. Bick, Alzheimer Disease, The changing
view. San Diego, Academic Press, 2000, 387.
R. Katzman and K. Bick, Cognitive decline in the elderly and
AD pathology The first prospective study: Newcastle, in:
Alzheimer disease, The changing view, R. Katzman and K.
Bick, eds, San Diego, Academic Press, 2000, pp. 4666.
R. Katzman and K. Bick, Experimental models. Henry Wisniewski, in: Alzheimer Disease, R. Katzman and K. Bick, eds,
San Diego, Academic Press, 2000, pp. 1128.
R. Katzman and K. Bick, Mikel Kidd, in: Alzheimer Disease,
The changing view, R. Katzman and K. Bick, eds, San Diego,
Academic Press, 2000, pp. 2846.
R. Katzman and K. Bick, The cholinergic story: Hope for the
patient and family, in: Alzheimer Disease, The changing view,
R. Katzman and K. Bick, eds, San Diego, Academic Press
2000, pp. 167210.
R. Katzman and K. Bick, The next act, in: Alzheimer Disease,
The changing view, R. Katzman and K. Bick, eds, San Diego,
Academic Press, 2000, pp. 353378.
[17]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
R. Katzman and K. Bick, The rediscovery of Alzheimer disease during the 1960s and 1970s, in: Concepts of Alzheimers
Disease, Biological, clinical, and cultural perspectives, P.J.
Whitehouse, K. Maurer and M.A. Ballenger, eds, Baltimore,
Johns Hopkins University Press, 2000, pp. 104114.
R. Katzman and K. Bick, The rise of the Alzheimers Association, in: Alzheimer Disease, The changing view, R. Katzman and K. Bick, eds, San Diego, Academic Press, 2000,
pp. 312351.
R. Katzman and K. Bick, The ultrastructure of AD. Robert
Terry, in: Alzheimer Disease, The changing view, R. Katzman
and K. Bick, eds, San Diego, Academic Press, 2000, pp. 11
28.
R. Katzman, The prevalence and malignancy of Alzheimers
disease, Arch Neurol 33 (1976), 299308.
E. Kraepelin, Psychiatric: Ein Lehrbuch fur Studierende und
Artze,
Leipizg, Barth, 1910, 11291136.
K. Maurer and U. Maurer, The Life of a Physician and the
Career of a Disease, Translated by N Levi with A Burns. New
York, Columbia University Pres, 2003, 270.
K. Maurer, S. Volk and H. Gerbaldo, Auguste D and
Alzheimers disease, Lancet 349 (1997), 15461549.
National Institute of Aging, Can Alzheimers disease be prevented? NIH Publications No. 05-5503, May 2005.
National Institute on Aging. Alzheimers disease Education
& Referral Center, Alzheimers disease Centers Program celebrates 20th anniversary, Connections 12(34) (20042005),
18.
B. Reisberg, R. Doody, A. Stoffler, F. Schmitt, S. Ferris and H.J. Mobius, Memantine Study Group. Memantine
in moderate-to-severe Alzheimers disease, N Engl J Med
348(14) (3 Apr. 2003), 13331341.
L.S. Schneider, Inhibidores de la colinesterasa: presente y futuro, in: En Alzheimer XXI: Ciencia y Sociedad, J.M. Martnez
Lage and Z.S. Kachaturian, eds, Barcelona, Masson, 2001,
pp. 245262.
D.J. Selkoe, Alzheimer disease: mechanistic understanding
predits novel therapies, Ann Intern Med 140 (2004), 627638.
D.J. Selkoe, Alzheimers disaease: genes, proteins, and therapy, Physiological Reviews 81 (2001), 742766.
D.J. Selkoe, Defining molecular targets to prevent Alzheimer
Disease, Arch Neurol 62 (2005), 192195.
W.K. Summers, L.V. Majovski, G.M. Marsh, K. Tachiki and
A. Kling, Oral tetrahydroaminoacridine in long-term treatment
of senile dementia, Alzheimer type, N Engl J Med 315(20) (13
Nov. 1986), 12411245.
R.D. Tanzi and A.B. Parson, Decoding Darkness, The search
for the genetic causes of Alzheimers disease. Cambridge,
Mass., Perseus, 2000, 281.
R.D. Tanzi, Genetics basis of cerebral amyloidosis, Alzheimer
& Dementia 1(Supl1) (2005), 1, Abstract AM-01.
A. Underwood, 7 Ways to save a Brain, Newswek Special
Issue. The future of medicine, Summer 2005, 32.
P.J. Whitehouse, D.L. Price, R.G. Struble, A.W. Clark, J.T.
Coyle and M.R. Delon, Alzheimers disease and senile dementia: loss of neurons in the basal forebrain, Science 215(4537)
(5 Mar 1982), 12371239.
P.J. Whitehouse, K. Maurer and M.A. Ballenger, eds, Concepts of Alzheimers Disease, Biological, clinical, and cultural perspectives. Baltimore, Johns Hopkins University Press,
2000, 341.
Neuropathology
29
Keywords: Alzheimers disease, morphometry, neurofibrillary tangles, Herpes simplex virus, hippocampus
1. Introduction
While on sabbatical leave in 1972 from the University of Western Ontario, London, Canada, it was my
honour to spend a study year abroad at the National
Hospital for Nervous Diseases, Queen Square, in the
Neuropathology Department of the University of London. There Dr. Anthony Dayan, a Faculty member under Professor William Blackwood, 1 and who was one
of the first to apply the new tool of morphometry to
what had hitherto been largely descriptive techniques
of pathological anatomy, had agreed to tutor me in the
nuances of quantitative histopathology.
1 . . . then busily editing the latest edition of Greenfields
Neuropathology.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
30
organic neurodegeneration, 2 had already begun to promulgate the understandably appealing notion that one
particular lesion seen in the Alzheimer victims brain
would ultimately prove to be the most robust explanation for patients cognitive deterioration.
Hence his landmark papers with psychiatrist Sir Martin Roth and with Dr. Gary Blessed (who did the actual
lesion-counting) on the correlation between number of
senile (neuritic) plaques and severity of dementia [7,
28,29] . . . although the statistical strength of that putatively linear correlation Tomlinson did acknowledge
was somewhat over-stated [26]. Nevertheless, his inherently attractive theory provided considerable momentum for the MRCs published advice that longitudinal clinicopathological studies, tracking many patients
until death and brain autopsy, would soon (if not eventually) reveal exactly which of the plethora of striking
cellular abnormalities observed more plentifully in AD
brains (senile plaques, neurofibrillary tangles, granulovacuoles, rod-like bodies of Hirano, nerve cell dropout) was the key lesion of blame.
It thus transpired that I returned to Canada sufficiently buoyed by this concept, and so naively enthusiastic to promote and commence trying the approach,
that in short order my very first grant application ever
submitted to the National Institutes of Health, USA
(a programmatic proposal from the Dementia Study
Group which I founded at the University of Western
Ontario) met with surprising fiscal success. 3 Dr. Zaven Khachaturian, one of the first NIH administrators
to capitalize upon the aging phenomena besetting geriatric members of the United States Congress, so avidly
supported our prototype of a comparative investigation of normal subjects and dementing individuals, that
very soon thereafter roughly twoscore such academic
Alzheimer research centres sprouted all across America, funded chiefly by the National Institute on Aging.
Who could have forecast in those halcyon days what
a tempest of confusion lay in wait for devotees of this
modus operandi?
2. Locus minoris resistentiae?
Much to my amazement, my morphometric paper
appearing in Acta Neuropathologica of 1977 [1] has
2 . . . popularized by the clinical Ischemic rating scale developed
by Dr. Vladimir Hachinski [11].
3 Some would opine that the American peer review system, unlikely the British, was (at least in those times) not infrequently as
much seduced by size of Grant proposal as by quality.
rillary tangles always make their C N S debut specifically here, in the hippocampal formation, we will be
within reach of unravelling the etiology of AD. The
subsequent staging schema advanced by Heiko and
Eva Braak [8], which cited neither Damasios nor our
own convictions about tangles in the mesial temporal cortex, surely reiterates all the same just how vital
such early entorhinal and adjacent temporal lobe lesions must be . . . even though if misused as a post-hoc
predictor of clinical severity their pathological staging
pattern falls short of the mark [22].
Moreover, a goodly number of more contemporary papers recurrently underscores the fact that limbic pathology both in Mild Cognitive Impairment
(MCI) [23] and in early AD remains persistently the
favoured patho-anatomic (and neuroimaging) basis for
distinguishing normal aging without cognitive decline
from preclinical and from earliest dementia of the
Alzheimer type [15,21,24,25].
At this juncture, then, rather than stirring yet again
the roiling caldron of Plaque-advocates versus tangleproponents, or of Tauists versus BAPPtists (? Betaamyloidopathists), I feel it far more useful to rephrase
the critical conundrum thusly: What is it about mesial
temporal lobe that renders it the locus minoris resistentiae, always the very first place we find neurofibrillary
tangles?
31
32
Fig. 1. Small sensory nerve fibres can be seen leaving the Trigeminal Ganglion (at left), proceeding towards the basilar meninges of the middle
and anterior cranial fossae (see SOLID arrows). Reproduced with permission from R.T. Johnson, Viral Infections of the Nervous System, 2nd
ed., Fig 6.3, page 142, Lippincott-Raven Press, Philadelphia, 1998.
have been steamrolling across this continent, too frequently discouraging those young investigators who
feel they have a really bright, novel and worthy idea to
pursue.
Whether Herpes simplex virus will ultimately prove
a major AD trigger, it is my fervent hope to stay tuned in
long enough to learn. And as with all scientific pursuits,
maybe the journey itself truly is more important than
its final destination.
[4]
[5]
[6]
[7]
Acknowledgements
[8]
[9]
[10]
[11]
References
[12]
[1]
[2]
[3]
M.J. Ball, Neuronal Loss, Neurofibrillary Tangles and Granulovacuolar Degeneration in the Hippocampus with Ageing
and Dementia a Quantitative Study, Acta Neuropathologica
37 (1977), 111118.
M.J. Ball, Limbic Predilection in Alzheimers Disease: Is reactivation of Latent Herpes Virus a Cause of Senile Dementia?,
Can. J. Neurol Sci 9 (1982), 303306.
M.J. Ball, K. Nuttall and K.G. Warren, Neuronal and Lymphocytic Populations in Human Trigeminal Ganglia: Implications
for Ageing and for Latent Virus, Neuropath. Appl. Neurobiol.
8 (1982), 177187.
[13]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
33
35
1. Preliminary remarks
Corresponding author: Prof. Heiko Braak, MD, Institute for Clinical Neuroanatomy, Theodor Stern Kai 7, D-60590 Frankfurt/Main,
Germany. Tel.: +49 69 6301 6900; Fax: +49 69 6301 6425; E-mail:
Braak@em.uni-frankfurt.de.
Alzheimers disease (AD) and spontaneously occurring Parkinsons disease (PD) are the most common
degenerative disorders of the human nervous system.
Both disorders affect multiple neuronal systems and involve pathological aggregation of potentially dangerous proteins in select neuronal types [14]. In AD,
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
36
susceptible nerve cells develop an abnormal fibrillary material chiefly consisting of altered microtubuleassociated tau protein, which appears in the form of
somatic neurofibrillary tangles (NFTs) and neuropil
threads (NTs) in cellular processes [8,29,45], whereas
in PD intraneuronal inclusion bodies predominantly
composed of the misfolded -synuclein protein occur
as Lewy bodies (LBs) and Lewy neurites (LNs) [2,21,
23,24,46]. In both illnesses, the vulnerability of specific nerve cell groups is reflected in a characteristic topographical distribution pattern of the lesions throughout the cerebral cortex that remains remarkably consistent across cases [4,11,16]. The aim of the present study
is to review some phylo- and ontogenetic trajectories
that pertain to the problem of selective vulnerability in
both AD and PD [15].
37
Fig. 1. (a) Composition of the human cerebral cortex. The allocortex (black) consists of the olfactory bulb, entorhinal region, hippocampal
formation, and associated areas. The mesocortex (cross-hatching) mediates toward the much larger neocortex. The latter consists of primary
sensory or motor fields (dark gray), first order sensory association areas or premotor areas (light gray), and related high-order sensory association
areas or prefrontal fields (white). (b) Neocortical myelination begins in the primary sensory and motor fields (dark gray) and progresses (white
arrows) via first order sensory association areas and premotor areas (medium gray) to the related high-order sensory association and prefrontal
areas (lighter gray tones, indicated by arrows). This results in dense myelination of the primary sensory and motor fields in the human adult. With
increasing distance from the primary fields, the average myelin content gradually lessens and is minimal in anterior portions of the mesocortex.
(c) An inverse relationship between the myelination process and the destruction of the neocortex exists in AD and/or PD. The first cortical lesions
occur in the anterior temporal mesocortex and extend into adjoining high-order association areas, eventually reaching the first order association
areas and primary fields of the neocortex (arrows). (df) Diagrams showing main subdivisions of the cerebral cortex and components of the
limbic loop. Via the afferent trunk of the limbic loop, data are funneled through the anterior temporal mesocortex to both the temporal allocortex
and amygdala. The efferent trunk of the limbic loop includes the ventral striatum, ventral pallidum, and mediodorsal thalamus; it directs data
to the prefrontal areas. (d) Initial changes in AD stages III and/or PD stage 4 mildly hamper the data flow from sensory association areas
to superordinate centers of the limbic system. (e) Moderately severe lesions in AD stages IIIIV and/or PD stage 5 tend to disconnect the
superordinate centers of the limbic system from the neocortex. (f) The destruction in AD stages VVI and/or PD stage 6 disconnect the neocortical
sensory association fields from the prefrontal cortex as well. Abbreviations: endocrine syst. endocrine system, first o. sens. ass. f. first order
sensory association fields, MD mediodorsal nuclei of the thalamus, olfact. input olfactory input, prim. sens. fields primary sensory fields,
ventr. pall. ventral pallidum, ventr. str. ventral striatum.
38
Fig. 2. Stages IIV of cortical neurofibrillary changes of the Alzheimer type in 100 m polyethylene glycol-embedded hemisphere sections
immunostained for abnormal tau (AT8, Innogenetics). Stage I: involvement is slight and all but confined to the transentorhinal region (part
of the temporal mesocortex), usually located on the medial surface of the rhinal or collateral sulcus (arrow). This section originates from a
non-demented 80 year-old female. Stage II: Additional immunoreactivity occurs in layer pre- or layer II of the entorhinal region (arrow). The
layer gradually sinks into a deeper position in the transentorhinal region (arrow). The border between entorhinal and transentorhinal regions
is clearly recognizable in these early stages (arrowhead). The section was obtained from a non-demented 80 year-old male. Stage III: The
lesions make headway into the hippocampal formation (arrow), layers pre- and, additionally, pri- of the deep entorhinal layers, the temporal
mesocortex (arrow) largely buried (between the arrowheads) in the banks of the rhinal sulcus, and eventually reach into the adjoining high order
sensory association areas of the temporal neocortex. The lesions do not extend beyond the occipitotemporal (arrow) and lingual gyri. The section
comes from a 90 year-old female. Stage IV: The third and fourth sectors of the Ammons horn and a large portion of the insular cortex (arrow)
become affected. The involvement of the neocortical high order sensory association cortex of the temporal lobe now extends up to the medial
temporal gyrus and stops short of the superior temporal gyrus. The primary fields of the neocortex (see gyrus of Heschl, marked by an arrow)
and to a large extent also the premotor and first order sensory association areas of the neocortex remain spared of the pathology. This section was
taken from an 82 year-old demented female. Scale bar applies to stage IIV.
39
Fig. 3. Stages VVI of cortical neurofibrillary changes of the Alzheimer type in 100 m polyethylene glycol-embedded hemisphere sections
immunostained for abnormal tau (AT8, Innogenetics). Stage V: In addition to the presence of AD-related lesions in all of the regions mentioned in
Fig. 2, pathological changes appear in the superior temporal gyrus (asterisk) and even encroach to a mild degree upon the premotor and first order
sensory association areas of the neocortex. In the occipital lobe, the peristriate region (Brodmann area 19) shows varying degrees of affection,
and lesions occasionally can even be seen in the parastriate area (Brodmann area 18). These sections were obtained from a 90 year-old female
with dementia. Stage VI: Strong immunoreactivity can be detected even in the first order sensory association areas (e.g., the parastriate area,
Brodmann area 18, arrows) and the primary areas of the neocortex (e.g., the striate area, Brodmann area 17, between arrowheads) of the occipital
neocortex. Compare the superior temporal gyrus (asterisk) and transverse gyrus of Heschl at stage V with the same structures at stage VI. Both
stage VI sections originate from a severely demented 70 year-old female Alzheimer patient who died of aspiration pneumonia. Left hand scale
bar applies to both hemisphere sections, right hand scale bar to both occipital sections.
40
41
42
begin lipofuscin accumulation early are especially vulnerable and develop neurofibrillary changes or Lewy
body pathology earlier in the disease process and at
greater densities [17]. In fact, the lesions commence
formation in the vicinity of the lipofuscin granules and
the poorly myelinated anteromedial temporal mesocortex is the site of the earliest AD- and/or PD-related
lesions in the cerebral cortex. By contrast, cortical
nerve cells that remain virtually free of lipofuscin deposits even at an advanced age resist the pathological
processes associated with AD and/or PD regardless of
the axons myelin status (e.g., the solitary cells of Cajal). Similarly, heavily myelinated projection neurons
do not develop NFTs or LBs even in the presence of
considerable lipofuscin deposition [17].
9. Future considerations
It is unclear whether or when the myelination process in human high-order associations areas ends and
under the influence of which factors. Were it possible to modify the maturation process so that vulnerable
cortical neurons could myelinate more effectively, they
might become more resistant to the AD- and PD-related
inclusion body pathologies [6]. To have an impact on
the prevalence of both disorders, it appears necessary to
prevent or at least postpone the beginning of the underlying disease process. Strategies designed to improve
cortical myelination and delay the possibly detrimental
accumulation of intraneuronal lipofuscin would have to
be implemented in early childhood and large numbers
of such individuals followed longitudinally.
Acknowledgements
This paper was supported by the Deutsche Forschungsgemeinschaft. We gratefully acknowledge the
skillful assistance of Ms. Birgit Meseck-Selchow (tissue preparation and immunohistochemistry) and Ms. I.
Szasz-Jacobi (graphics).
References
[1]
[2]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
43
44
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
J.Q. Trojanowski and V.M.Y. Lee, Fatal attractions of proteins. A comprehensive hypothetical mechanism underlying
Alzheimers disease and other neurodegenerative disorders,
Ann. N. Y. Acad. Sci. 924 (2000), 6267.
M.S. van der Knaap and J. Valk, Magnetic Resonance
of Myelin, Myelination, and Myelin Disorders, (2nd ed.),
Springer, Berlin, 1995.
M.S. van der Knaap, J. Valk, C.J. Bakker, M. Schooneveld,
J.A.J. Faber, J. Willemse and P.H.J.M. Gooskens, Myelination
as an expression of the functional maturity of the brain, Dev.
Med. Child Neurol. 33 (1991), 849857.
P.I. Yakovlev and A.R. Lecours, The myelogenetic cycles of
regional maturation of the brain, in: Regional development of
the brain in early life, A. Minkowksi, ed., Blackwell, Oxford,
1967, pp. 370.
K. Zilles, Architecture of the human cortex, in: The Human
Nervous System, (2nd ed.), G. Paxinos and J.K. Mai, eds,
Elsevier Academic Press, San Diego, London, 2004, pp. 997
1060.
45
1. Introduction
The invitation to participate in the commemorative
issue celebrating the 100 th anniversary of Dr. Alois
Alzheimers first report on the disease that would later
bear his name has evoked memories of my career [1].
I first became familiar with the concept of dementia when in high school I read the following in one of
Juvenalis (60140 A.D.) satires: . . . omni membrorum damno major dementia, quae nec nomina servorum
nec vultum agnoscit amici, cum quo praeterita coenavit
nocte, nec illos, quos genuit, quos eduxit; . . . worse
still than all decay of limbs is memorys decay, which
recalls neither his slaves names nor the friends features, with whom he supped but yesternight, nor those
whom he begot and bred [46]. Only a few years later,
a more complete picture of dementia started to unfold
in front of me. As a medical student, I started an internship in the Institute of Psychiatry at the University
of Pisa in 1963. The director of the institute at that time
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
46
able to observe how maytansine, maytanprine, nocodazole and other agents affected microtubules, induced
neurofibrillary pathology and affected the axoplasmic
transport [1921,25,33,71]. Using metallic aluminum
powder, a chronic intoxication was induced that led to
the accumulation of neurofilaments and to nerve cell
loss [7,25,31,89]. In spite of multiple attempts, the
formation of the type of tangles that were characteristic of Alzheimer disease never took place. In the area
of neurological mutant mice, numerous studies using
the weaver mutant mice and Purkinje cell degeneration
mice were carried out for over twenty years [24,32,
34,3840,47,4951,72,73,88,9092,94,97102]. One
important finding was the discovery that the neurons
of the substantia nigra in weaver mutant mice degenerate causing a severe dopamine deficiency in the nigrostriatal system [73]. These animal studies involved
many people and I am particularly grateful to the following for their interactions: S. Bayer, S. Dlouhy, M.E.
Hodes, M.J. Schmidt, L.C. Triarhou, T. Verina, and J.
Wei.
My work on human hereditary dementia began in
1976 by studying the neuropathology of an autosomal
dominant form of Alzheimer disease in a family that
had been identified by Dr. Zeman. Over the subsequent
30 years, my work involved several forms of hereditary
dementias and numerous families.
The approach has been that of studying carefully
the main neuropathologic characteristics of any given
genetically-determined dementing illness, identifying
unique features of the disease process by classic neuropathology, and electron microscopy. As new techniques of immunohistochemistry, biochemistry, and
molecular genetics became available to my laboratory,
our approach widened to include the immunohistochemical and biochemical characterization of protein
deposits as well as the genetic linkage analysis and
DNA sequencing of candidate genes.
I was very fortunate that many investigators shared
their enthusiasm and expertise in these research efforts.
I am particularly grateful to the following people for
their contributions in molecular genetic and biochemical studies: M. Benson, R.A. Crowther, S. Dlouhy,
B. Frangione, M. Goedert, A. Klug, L. Miravalle, J.
Murrell, P. Parchi, P. Piccardo, S. Prusiner, A. Roher,
M.G. Spillantini, F. Tagliavini, R. Vidal and K. Young.
I am equally grateful to the following individuals for
their contributions in the neuropathologic studies: O.
Bugiani, B. Crain, E. Cochran, M.B. Delisle, P. Gambetti, G. Giaccone, J. Ironside, S. Mirra, P.K. Panegyres, S. Spina, M. Takao and K. Yamaguchi. Also, the
47
48
Presenilin 2 gene
Mutations
V717F*, V717L*
A79V, F105L, Y115C, M139V, I143T, M146L, L166P*, S169L,
G217D*, K239E, A260V, V261F, V261I, P264L, R269G, C410Y,
A426P, A431E*, del exon 9
N141I
Table 2
Prion disease
Disease
GSS
PrP-CAA
fCJD
Mutations
P102L, A117V, G131V, H187R, F198S*, D202N*, Q212P*, Q217R
Y145 Stop
E200K, V210I
Table 3
FTDP-17
Gene
Tau gene
Mutations
N279K, P301L, P301S*, S305N, Exon 10 +3*, Exon 10 +16, G389R*, R406W
Table 4
Other dementias
Gene
Neuroserpin gene
Ferritin Light Polypeptide gene
Mutations
S52R
498-499insTC
logic examination followed by biochemical and molecular genetic analyses [81,84,96]. Recently, we have
studied diseases that are characterized by the accumulation of neuroserpin in neurons and ferritin in neurons and glia (Table 4). Dr. Benson and Dr. Murrell
have found the mutation in the neuroserpin protein and
Neuroserpin gene respectively [81,106]. Dr. Vidal
has characterized a hereditary ferritinopathy associated
with severe deposition of ferritin peptides throughout
the central nervous system and tc duplications in Ferritin Light Polypeptide gene [96].
As Alois Alzheimer stated in the closing of his 1907
paper, the same words are still true today. His words
were On the whole, it is evident that we are dealing
with a peculiar, little known disease process. In recent
years, these particular disease-processes have been detected in great numbers. This fact should stimulate us
to further study and analysis of this particular disease.
We must not be satisfied to force it into the existing
group of well-known disease patterns. It is clear that
there exists many more mental diseases than our text
books indicate. In many such cases, a further histological examination must be effected to determine the characteristics of each single case. We must reach the stage
in which the vast well-known disease groups must be
subdivided into many smaller groups, each one with its
own clinical and anatomical characteristics.
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
A. Alzheimer, Uber
eine eigenartige Erkrankung der Hirnrinde, Allg Z Psychiatrie Psychisch-Gerichtl Med. 64 (1907),
146148.
B. Azzarelli, J. Muller, B. Ghetti, M. Dyken and P.M.
Conneally, Cerebellar plaques in familial Alzheimers disease (Gerstmann-Straussler-Scheinker Variant?), Acta Neuropathol. (Berl) 65 (1985), 235246.
S.A. Bayer, K.V. Wills, L.C. Triarhou, T. Verina, J.D. Thomas
and B. Ghetti, Selective vulnerability of late-generated
dopaminergic neurons of the substantia nigra in weaver mutant mice, Proc. Natl. Acad. Sci. USA 92 (1995), 92379140.
S.A. Bayer, K.V. Wills, J. Wei, Y. Feng, S. Dlouhy, M.E.
Hodes, T. Verina and B. Ghetti, Phenotypic effects of the
weaver gene are evident in the embryonic cerebellum but
not in the ventral midbrain, Develop. Brain Res. 96 (1996),
130137.
B. Boeve, I.W. Tremont-Lukats, A.J. Waclawik, J.R. Murrell, B. Hermann, C.R. Jack, M.M. Shiung, G.E. Smith, D.S.
Knopman, A.R. Nair, N. Lindor, V. Koppikar and B. Ghetti,
Longitudinal Characterization of Two Siblings with frontotemporal dementia associated with the S305N Tau mutation, Brain 128 (2005), 752772.
L. Van Bogaert, M. Maert and E. De Smedt, Sur les formes
familiaires precoces de la maladie d Alzheimer, Monatschr.
Psychiatrie 102 (1940), 249.
O. Bugiani and B. Ghetti, Progressing encephalomyelopathy with muscular atrophy, induced by aluminum powder,
Neurobiol. Aging 3 (1982), 209222.
O. Bugiani, G. Giaccone, B. Frangione, B. Ghetti and F.
Tagliavini, Alzheimer patients: preamyloid deposits are
more widely distributed than senile plaques throughout the
central nervous system, Neurosci. Lett. 103 (1989), 263268.
O. Bugiani, J.R. Murrell, G. Giaccone, M. Hasegawa, G.
Ghigo, M. Tabaton, M. Morbin, A. Primavera, F. Carella, C.
Solaro, M. Grisoli, M. Savoiardo, M.G. Spillantini, F. Tagliavini, M. Goedert and B. Ghetti, Frontotemporal dementia
and corticobasal degeneration in a family with a Pro301Ser
mutation in tau, J. Neuropathol Exp Neurol 58 (1999), 667
677.
G.B. Cassano, B. Ghetti, E. Gliozzi and E. Hansson, Autoradiographic distribution study of Short-Acting and
Long-Acting barbiturates: S35-Thiopentone and C14Phenobarbitone, Br. J. Anaesthesia 39 (1967), 1120.
G.B. Cassano, P.L. Viola, B. Ghetti and L. Amaducci, The
distribution of inhaled mercury (Hg203) vapors in the brain
of rats and mice, J. Neuropathol. Exp. Neurol. 28 (1969),
308320.
M.-B. Delisle, J. Murrell, R. Richardson, J.A. Trofatter, O.
Rascol, X. Soulages, M. Mohr, P. Calvas and B. Ghetti, A
mutation at codon 279 (N279K) in exon 10 of the tau gene
causes a tauopathy with dementia and supranuclear palsy,
Acta Neuropathol. 98 (1999), 6277.
S.R. Dlouhy, K. Hsiao, M.R. Farlow, T. Foroud, P.M. Conneally, P. Johnson, S.B. Prusiner, M.E. Hodes and B. Ghetti,
Linkage of the Indiana kindred of Gerstmann-StrausslerScheinker disease to the prion protein gene, Nature Genet. 1
(1992), 6467.
M.R. Farlow, B. Ghetti, M.D. Benson, J.S. Farrow, W.E. Van
Nostrand and S.L. Wagner, Low cerebrospinal-fluid concentrations of soluble amyloid -protein precursor in hereditary
Alzheimers disease, The Lancet. 340 (1992), 453454.
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
49
M.R. Farlow, B. Ghetti, S.R. Dlouhy, G. Giaccone, O. Bugiani, F. Tagliavini and S. Wagner, Cerebrospinal fluid levels of amyloid -protein precursor are low in GerstmannStraussler-Scheinker, Indiana kindred, Neurology, 44 (1994),
15081510.
M.R. Farlow, J. Murrell, B. Ghetti, F. Unverzagt, S. Zeldenrust and M.D. Benson, Clinical characteristics in a kindred
with early onset Alzheimers disease and their linkage to a G
to T change at position 2149 of the amyloid-precursor protein
gene, Neurology 44 (1994), 105111.
M.R. Farlow, J.R. Murrell, F.W. Unverzagt, M. Phillips, M.
Takao, C. Hulette and B. Ghetti, Familial Alzheimers Disease with Spastic Paraparesis Associated with a Mutation at
Codon 261 of the Presenilin 1 Gene, in: Alzheimers Disease: Advances in Etiology, Pathogenesis and Therapeutics,
K. Iqbal, S.S. Sisodia and B. Winblad, eds, John Wiley and
Sons Ltd., Chichester, England, 2001, pp. 5360.
A. Gemignani, P. Pietrini, J.R. Murrell, B.S. Glazier, P. Zolo,
M. Guazzelli and B. Ghetti, Slow wave and REM sleep mechanisms are differently altered in hereditary Pick disease associated with the Tau G389R mutation, Arch. Italiennes de
Biologie 143 (2005), 6579.
B. Ghetti, Induction of neurofibrillary degeneration following treatment with maytansine in vivo, Brain Res. 163 (1979),
919.
B. Ghetti, Experimental studies on neurofibrillary degeneration, in: Aging of the Brain and Dementia, Aging, (Vol. 13),
L. Amaducci, A.N. Davison and P. Antuono, eds, Raven
Press, New York, NY, 1980, pp. 183198.
B. Ghetti, C. Alyea, J. Norton and S. Ochs, Effects of vinblastine on microtubule density in relation to axoplasmic
transport, in: Axoplasmic Transport, D. Weiss, ed., SpringerVerlag, New York, Wien, 1982, pp. 322327.
B. Ghetti, A. Amati, M.V. Turra, A. Pacini, M. Del Vecchio
and G.C. Guazzi, Werdnig-Hoffmann-Wohlfart-KugelbergWelander disease: nosological unity and clinical variability
in intrafamilial cases, Acta Geneticae Medicae et Gemellologiae 20 (1971), 4358.
B. Ghetti, S.R. Dlouhy, G. Giaccone, O. Bugiani, B. Frangione, M.R. Farlow and F. Tagliavini, Gerstmann-StrausslerScheinker disease and the Indiana Kindred, Brain Pathol. 5
(1995), 6175.
B. Ghetti, R.W. Fuller, B.D. Sawyer, S.K. Hemrick-Luecke
and M.J. Schmidt, Purkinje cell loss and the noradrenergic
system in the cerebellum of pcd mutant mice, Brain Res.
Bull. 7 (1981), 711714.
B. Ghetti and P. Gambetti, Comparative immunocytochemical characterization of neurofibrillary tangles in experimental
maytansine and aluminum encephalopathies, Brain Res. 277
(1983), 388393.
B. Ghetti, G.C. Guazzi, R.V. De Masi and A. Cecio, Epilessia
mioclonica giovanile con macchia rosso-ciliegia al fordo dellocchio, Studio istologico ed ultrastrutturale della biopsia
epatica, Acta Neurol. 25 (1970), 252260.
B. Ghetti, D.S. Horoupian and H.M. Wisniewski, Transsynaptic response of the lateral geniculate nucleus and the pattern of degeneration of the nerve terminals in the rhesus monkey after eye enucleation, Brain Res. 45 (1972), 3148.
B. Ghetti, D.S. Horoupian and H.M. Wisniewski, Acute
and long-term transneuronal response of dendrites of lateral
geniculate neurons following transection of the primary visual afferent pathway, in: Physiology and Pathology of Dendrites, Advances in Neurology, (Vol. 12), G.W. Kreutzberg,
ed., Raven Press, New York, NY, 1975, pp. 401424.
50
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[74]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
51
52
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]
[102]
[103]
[104]
[105]
[106]
[107]
[108]
[109]
53
Keywords: Alzheimers disease, Alzheimers neurofibrillary changes, parkinsonism-dementia complex on Guam, topographic
study
1. Introduction
Corresponding author: Asao Hirano, M.D., Division of Neuropathology, Department of Pathology, Montefiore Medical Center, 111 East 210th Street, Bronx, New York, 10467-2094 USA.
Tel.: +1 718 920 4447; Fax: +1 718 653 3409; E-mail: ahirano@
montefiore.org.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
54
A. Hirano and M. Iida / Topographic study of Alzheimers neurofibrillary changes: A personal perspective
Analyzing 108 brains, including 48 with senile dementia, in 1911 Simchowicz [58] stressed the Ammons horn as the area of predilection for neurofibrillary changes. He observed more of these alterations
in the frontal and temporal cortexes and fewer in the
occipital, motor and sensory cortex. He did not describe them in the brain stem but emphasized their absence in the cerebellum and spinal cord. As cases accumulated, topographic studies of Alzheimers neurofibrillary changes, especially in the cerebral cortex were
made by many investigators [23].
A. Hirano and M. Iida / Topographic study of Alzheimers neurofibrillary changes: A personal perspective
55
6. Further studies
6.1. Occurrence of Alzheimers neurofibrillary
changes
Since these studies, aged brains of Caucasians without known neurological disease have been shown to
contain small numbers of Alzheimers neurofibrillary
tangles [23]. Furthermore, while usually fewer than
in Guamanian ALS or PDC patients, the tangles were
present and distributed in a similar manner in the
Chamorros who died of other causes [4,26]. Numbers
of affected neurons with neurofibrillary changes were
more in Chamorros than Caucasians.
There have been other reports in which numerous
Alzheimers neurofibrillary changes have been found
in wide distributions in the central nervous system.
56
A. Hirano and M. Iida / Topographic study of Alzheimers neurofibrillary changes: A personal perspective
A. Hirano and M. Iida / Topographic study of Alzheimers neurofibrillary changes: A personal perspective
57
58
A. Hirano and M. Iida / Topographic study of Alzheimers neurofibrillary changes: A personal perspective
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
A. Alzheimer, Uber
eigenartige Krankheitsfalle des spateren
Alters, Z Ges Neurol Psychiat 4 (1911), 356385.
F.H. Anderson, E.P. Richardson, Jr., H. Okazaki and J.A.
Brody, Neurofibrillary degeneration on Guam. Frequency in
Chamorros and non-Chamorros with no known neurological
disease, Brain 192 (1979), 6577.
H. Autio-Harmainen, A. Oldfors, P. Saurander, M. Renlund,
K. Dammert and S. Sinuila, Neuropathology of Salla disease,
Acta Neurolopathol 75 (1988), 481490.
M.J. Ball, Neurofibrillary tangles in the dementia of normal
pressure hydrocephalus, Can J Neurol Sci 3 (1976), 227235.
H. Braak and E. Braak, Neuropathological staging of
Alzheimer-related changes, Acta Neuropathol 82 (1991), 239
259.
P. Burger and F.S. Vogel, The development of the pathologic
changes of Alzheimers disease and senile dementia in patients
with Downs syndrome, Am J Pathol 73 (1973), 457468.
J.A.N. Corsellis, Subacute sclerosing leukoencephalitis: clinical and pathological report of 2 cases, J Mental Sci 95 (1951),
570583.
J.A.N. Corsellis, C.J. Bruton and D. Freeman-Browne, The
aftermath of boxing, Psychol Med 3 (1973), 270303.
K.M. Cullen and G.M. Halliday, Neurofibrillary tangles in
chronic alcoholics, Neuropathol Applied Neurobiol 21 (1995),
312318.
D. Eidelberg, A. Sotrel, C. Joachim, D. Selkoe, A. Forman,
W.W. Pendlebury and D.P. Perl, Adult onset HallervordenSpatz disease with neurofibrillary pathology: a discrete clinicopathological entity, Brain 110 (1987), 9931013.
M.M. Esiri and G.K. Wilcock, The olfactory bulbs in
Alzheimers disease, J Neurol Neurosurg Psychiatry 47
(1984), 5660.
K.J. Fan and G. Pezeshkpour, Neurofibrillary tangles in association with congenital hydrocephalus, J Natl Med Assoc 79
(1987), 10011004.
M.B. Feany and D.W. Dickson, Widespread cytoskeletal
pathology characterizes corticobasal degeneration, Am J
Pathol 146 (1995), 13881396.
L.S. Forno, Reaction of the substantia nigra to massive basal
ganglia infarction, Acta Neuropathol 62 (1983), 96102.
S. Forno, P.J. Barbour and R I. Norville, Presenile dementia
with Lewy bodies and neurofibrillary tangles, Arch Neurol 35
(1978), 818822.
J.F. Geddes, G.H. Vowles, S.F.D. Robinson and C. Sutcliffe,
Neurofibrillary tangles, but not Alzheimer-type pathology, in
a young boxer, Neuropathology Appl Neurobiol 22 (1996),
1216.
J.G. Greenfield and F.D. Bosanquet, The brain-stem lesions in
parkinsonism, Neurol Neurosurg Psychitry 231 (1953), 213
226.
K. Harada, W. Krucke, J.L. Mancardi and T.I. Mandybur,
Alzheimers tangles in sudanophilic leukodystrophy, Neurology 38 (1988), 5559.
J. Harper, B.W. Scheithauer, H. Okazaki and E.R. Laws, Jr.,
Meningo-angiomatosis: a report of six cases with special ref-
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
erence to the occurrence of neurofibrillary tangles, J Neuropathol Exp Neurol 45 (1986), 426446.
A. Hirano and H. Tomiyasu, A guide to neuropathology, IgakuShoin, Tokyo, 2003.
A. Hirano and H.M. Zimmerman, Alzheimers neurofibrillary
changes. A topographic study, Arch Neurol 7 (1962), 227224.
A. Hirano, L.T. Kurland, R.S. Krooth and S. Lessell,
Parkinsonism-dementia complex, an endemic disease on the
island of Guam: 1. Clinical features, Brain 84 (1961), 642
661.
A. Hirano, N. Malamud and L.T. Kurland, Parkinsonismdementia complex, an endemic disease on the island of Guam:
2. Pathological features, Brain 84 (1961), 662679.
A. Hirano, N. Malamud, T.S. Elizan and L.T. Kurland, Amyotrophic lateral sclerosis and parkinsonism-dementia complex
on Guam. Further pathological studies, Arch Neurol 15 (1966),
3551.
A. Hirano, R. Tuazon and H.M. Zimmerman, Neurofibrillary
tangles, granulovacuolar bodies and argentophilic globules
observed in tuberous sclerosis, Acta Neuropathol 11 (1968),
257261.
P.R. Hof, C. Bouras, L. Buee, A. Delacourte, D.P. Perl and J.H.
Morrison, Differential distribution of neurofibrillary tangles
in the cerebral cortex of dementia pugilistica and Alzheimers
disease cases, Acta Neuropathol 85 (1992), 2330.
P.R. Hof, A. Charpiot, A. Delacourte, L. Buee, D. Purohit,
D.P. Perl and C. Bouras, Distribution of neurofibrillary tangles
and senile plaques in the cerebral cortex in postencephalitic
parkinsonism, Neurosci Lett 139 (1992), 1014.
P.R. Hof, A. Delacourte and C. Bouras, Distribution of cortical
neurofibrillary tangles in progressive supranuclear palsy: a
quantitative analysis of six cases, Acta Neuropathol 84 (1992),
4551.
P.R. Hof, D.P. Perl, A.L. Loerzel and J.H. Morrison, Neurofibrillary tangle distribution in the cerebral cortex of
parkinsonism-dementia cases from Guam: differences with
Alzheimers disease, Brain Res 564 (1991), 306313.
A. Hori, R. Weiss and T. Schaake, Ganglioglioma containing
osseous tissue and neurofibrillary tangles, Arch Pathol Lab
Med 122 (1988), 653655.
D.S. Horoupian and S. S. Yang, Paired helical filaments in
neurovisceral lipidoses (Juvenile dystrophic lipidoses), Ann
Neurol 4 (1978), 404-411.
T. Ishii, Distribution of Alzheimers neurofibrillary changes
in the brain stem and hypothalamus of senile dementia, Acta
Neuropathol 6 (1966), 181187.
T. Kato, A. Hirano, T. Katagiri, H. Sasaki and S. Yamada, Neurofibrillary tangle formation in the nucleus basalis of Meynert
ipsilateral to a massive cerebral infarct, Ann Neurol 23 (1988),
620623.
H. Kawasaki, S. Murayama, M. Tomonaga, N. Izumiyama
and H. Shimada, Neurofibrillary tangles inhuman upper cervical ganglia: morphological study with immunohistochemistry and electron microscopy, Acta Neuropathol 75 (1987),
156159.
T. Kovacs, N.J. Cairns and P.L.Lantos, -amyloid deposition
and neurofibrillary tangle formation in the olfactory bulb in
aging and Alzheimers disease, Neuropathol Appl Neurobiol
25 (1999), 481491.
T. Kovacs, N.J. Cairns and P.L. Lantos, Olfactory Centers
in Alzheimers disease: olfactory bulb is involved in early
Braaks stages, Neuroreport 12 (2001), 285288.
A. Hirano and M. Iida / Topographic study of Alzheimers neurofibrillary changes: A personal perspective
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[71]
[72]
59
T. Simchowicz, Histologische Studien uber die senille Demenz, in: Histologische und Histopathologische Arbeiten
u ber die Grosshirnrinde mit besonderer Berucksichtiung der
pathologischen Anatomie der Geisteskrankenheiten, (Vol. 4),
F. Nissl and A. Alzheimer, eds, Jena, Germany, Gustav Fischer
Verlag, 1911, pp. 267444.
D. Soffer, F. Umansky and J.E. Goldman, Ganglioglioma
with neurofibrillary tangles (NFTs): neoplastic NFTs of
Alzheimers disease, Acta Neuropathol 89 (1995), 451453.
M.G. Spillantini, T.D. Bird and B. Ghetti, Frontotemporal
dementia and parkinsonism linked to chromosome 17: A new
group of tauopathies, Brain Pathology 8 (1998), 387402.
J.C. Steel, J.C. Richardson and J. Olszewski, Progressive
supranuclear palsy: a heterogeneous degeneration involving
the brain stem, basal ganglia and cerebellum with vertical gaze
and pseudobulbar palsy, nuchal dystonia and dementia, Arch
Neurol 10 (1964), 333359.
K. Suzuki, C.C. Parker, P.G. Penchev, D. Katz, B. Ghetti,
A.N. DAgostino and E.D. Carstea, Neurofibrillary tangles in
Niemann-Pick disease type C, Acta Neuropathol 89 (1995),
227238.
K. Takada and L.E. Becker, Cockaynes syndrome: report
of two autopsy cases associated neurofibrillary tangles, Clin
Neuropathol 5 (1986), 6468.
K. Takada, Y.-S. Rin, S. Kasagi, K. Sato, H. Nakamura and J.
Tanaka, Long survival in Fukuyama congenital muscular dystrophy: occurrence of neurofibrillary tangles in the Nucleus
basalis of Maynert and locus ceruleus, Acta Neuropathol 71
(1986), 228232.
K. Tsuchiya, H. Nakayama, S. Iritani, T. Arai, K. Niizato, C.
Haggai, M. Matsushima and K. Ikeda, Distribution of basal
ganglia lesions in diffuse Neurofibrillary tangles with calcification: a clinicopathological study of five autopsy cases, Acta
Neuropathol 103 (2002), 555564.
T. Umahara, A. Hirano, S. Kato, N. Shibata and S.-H. Yen,
Demonstration of neurofibrillary tangles and neuropil threadlike structures in spinal cord white matter in parkinsonismdementia complex on Guam and in Guamanian amyotrophic
lateral sclerosis, Acta Neuropathol 88 (1994), 180184.
T. Umahara, A. Hirano, S. Kato, N. Shibata and S.-H. Yen,
Demonstration of neuropil thread-like structures in the spinal
cord white matter in progressive supranuclear palsy: An immunohistochemical investigation, Neuropathology 15 (1995),
103107.
T. Umahara, A. Hirano, N. Shibata, S. Kato and T. Kawanami,
Demonstration of neurofibrillary tangles in the indusium griseum and axonal disturbances in sagittal sulcal lesions of
the corpus callosum: An immunohistochemical investigation,
Neuropathology 16 (1996), 1014.
K. Wakabayashi, A. Furuta, H. Takahashi and F. Ikuta, Occurrence of neurofibrillary tangles in celiac ganglia, Acta Neuropathol 78 (1989), 448.
K. Wakabayashi, S. Hayashi, T. Morita, Y. Shibasaki, Y.
Watanabe and H. Takahashi, Neurofibrillary tangles in the peripheral sympathetic ganglia of non-Alzheimer elderly individuals, Clin Neuropathol 18 (1999), 171175.
P.J. Whitehouse, D.L. Price, A.W. Clark, J.T. Coyle and M.R.
De Long, Alzheimer disease: evidence for selective loss of
cholinergic neurons in the nucleus basalis, Ann. Neurol 10
(1981), 122126.
K. Wisniewski, G.A. Jervis, R.C. Moretz and H.M. Wisniewski, Alzheimer neurofibrillary tangles in diseases other
than senile and presenile dementia, Ann Neurol 5 (1979), 288
294.
60
[73]
A. Hirano and M. Iida / Topographic study of Alzheimers neurofibrillary changes: A personal perspective
M. Nakamura, Subacute dementia with necrotising encephalitis selectively involving the fornix and splenium: retrograde
development of Alzheimers neurofibrillary tangles in subiculum, J Neurol Sci 96 (1990), 159172.
[76] N. Yoshimura, M. Otake, K. Igarashi, M. Matsunaga, K.
Takebe and H. Kudo, Topography of Alzheimers neurofibrillary change distribution in myotonic dystrophy, Clin Neuropathol 9 (1990), 234239.
61
Keywords: Dementia disorders, Alzheimer disease, clinico-pathological correlations, diagnostic accuracy rates
1. Introduction
In 1990, the relative incidence of major types of dementia disorders and the agreement rates between clinical and neuropathological diagnosis were analysed in
a consecutive autopsy series of 675 elderly subjects in
Vienna, Austria (mean age 79.5, SD 9.6 years). Clin-
ical diagnosis of probable or possible Alzheimer disease (AD) was made in 59.2%, of vascular dementia
(VaD) in 21.7%, of mixed AD+VaD dementia in 3.1%,
of Parkinsons disease (PD) and other dementing disorders in 16%. At autopsy, 76.7% fulfilled the histological criteria for Alzheimer disease, but only 60% were
pure forms, while 8.2% showed additional features
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
62
63
Table 1
Likelihood of dementia (in percent) due to AD according to NIA-R-Institute criteria in
various autopsy series
Disorder
CERAD/Braak:
Low
A/0II
Interm.
B/IIIIV
High
C/V/VI
Mean age
(years)
47
72.5
41
22.5
12
5
?
?
0
48
75
76
3
26
17
24
97
26
8
0
83
81
68
77
26/13
73
83
83
20/27
18
17
17
54/60
9
0
0
77
76
79
79
88
12
84
0
62
17
38
83
0
81
83
0
25
70
25
70
100
24
33
20
50
30
0
76
42
10
25
0
0
85
77
72
83
72
81
64
3. Results
In the current autopsy cohort of over 1000 elderly demented individuals with a mean age of 83.4 6.0 years,
collected in a 15-year period from two large general
hospitals with chronic (geriatric) care facilities, retrospective evaluation of major clinical diagnosis revealed
62.9% possible or probable AD, 10.0% VAD, 9.5%
PD with dementia (PDD), and 1.5% mixed dementia,
while 10.4% were classified degenerative dementias,
and 5.7% were considered other dementing disorders,
including Creutzfeldt-Jakob and Huntingtons disease,
frontotemporal dementias, and others.
At autopsy, among the total series, 86% revealed
AD-related pathology, but only 42.8% showed pure
AD of the classical plaque and tangle type and 7.4% had
other or atypical AD forms, e.g. plaques-only type,
limbic AD (Braak stages up to 4), or neurofibrillary
predominant type of senile dementia (NFT/SD), with
neurofibrillary pathology mainly in the limbic system
with no or very little amyloid deposits (see [32]). In
the rest of cases, AD pathology was associated with
various forms of cerebrovascular pathology (lacunar
state, recent or old infarcts, hippocampal sclerosis)
22.6%, Lewy body pathology (either DLB or AD plus
PD, nigral lesions or so-called incidental Lewy body
disease) 10.8%, while 3.1% fulfilled current criteria
of mixed dementia (AD plus severe lacunar state or
multiple small or larger infarcts totalling up to 50 ml).
14% of the demented cohort revealed other pathologies:
7.3% showed different types of cerebrovascular pathology without AD lesions surmounting age-related limits multiple infarct encephalopathy (MIE), subcortical
atherosclerotic encephalopathy (SAE) or strategic infarct encephalopathy (SID), while 5.7% were other disorders associated with dementia (Creutzfeldt-Jakob and
Huntington disease, FTD, chronic alcoholism, etc.). In
one percent, the morphological basis of dementia was
not detected even with extensive neuropathological and
immunohistochemical investigations; they all had senile plaques but no isocortical neuritic AD lesions, with
Braak stages below 3 and no further abnormalities (Table 2A).
Similar results were seen in the group of 660 clinically suspected AD patients. They showed AD pathology in 93%, which, however, was pure in only 44.7%,
while additional minor to moderate cerebrovascular lesions not fitting the criteria of mixed dementia were
present in 27.7% and additional LB pathology in 10.1%
(4.5% with criteria of DLB and 6.1% of PDD, i.e. combination of AD+PD), AD with nigral lesions and/or
incidental Lewy body pathology, 1.8% each, corresponded to mixed dementia or showed AD plus other
pathologies (multiple sclerosis, multisystem atrophy,
tumors, etc.). Among the 6.8% non-AD cases, 2.4%
showing pure vascular pathology without essential
AD lesions were diagnosed VaD, while 3.8% represented other degenerative disorders associated with dementia. This group of clinically suspected AD included the following pathologies: FTD/Picks disease
(n = 12), CJD and brain tumor (n = 3 each), corticobasal degeneration (n = 2), and single cases of
PSP, HIV-encephalitis, Huntingtons disease, familial
insomnia, and intravascular non-Hodgkins lymphoma
(n = 1 each). 0.6% of this sample showed nothing
abnormal beyond normal aging (Table 2B).
These data indicate that, although pure VaD and
mixed dementia in large autopsy series of aged demented individuals are less frequent than previously
suggested, combination of cerebrovascular lesions with
AD pathology is rather frequent [3,28,35,62].
Comparison of clinical and postmortem diagnoses
gave the following results (see Table 2B, Fig. 1):
Among 660 patients with the clinical diagnosis of possible or probable AD, postmortem confirmation was
achieved in 93%, with PD+AD and DLB in 10.6%,
VaD and mixed dementia in 2.4 and 1.8%, respectively,
while 3.8% revealed other disorders, and 0.6% revealed
nothing abnormal beyond age-related changes. In the
group of patients with the clinical diagnosis of nonspecific/degenerative dementias (n = 109), around
78% were pathologically definite AD, less than 8%
VAD, 6.7% mixed dementia, and the rest other dementing disorders (e.g. single cases of posttraumatic
encephalopathy, atypical encephalitis, or Wernicke encephalopathy), with three negative cases. The clinical diagnosis of VAD (N = 105) was confirmed in
52.3%, while 32.4% morphologically revealed AD with
or without lacunar states and/or mild cerebrovascular
lesions, and 15.3% represented mixed dementia, i.e.
definite AD (Braak stages 5 or 6) combined with severe lacunar state, multiple cortical and/or subcortical
microinfarcts or larger cortical infarcts. In the clinical
PDD group (n = 100) DLB and PD+AD accounted
for 35 and 29%, respectively, pure AD without subcortical LB pathology was seen in 29% and pure PD
(usually Braak PD stages 4 and 5) [10] without further
65
(A)
n
400
78
277
28
55
58
33
14
903
77
60
10
147
1050
%
38.1
7.4
22.6
2.7
5.2
5.6
3.1
1.3
86.0
7.3
5.7
1.0
14.0
100.0
(B)
n
280
43
183
15
30
40
12
12
615
16
25
4
45
660
%
42.4
6.5
27.7
2.3
4.5
6.1
1.8
1.8
93.1
2.4
3.8
0.6
6.8
100.0
Nothing
abnormal
PDD + SiD
PD
Others
MIX
VaD
DLB
PD + AD
Def. AD
%
80
60
40
20
AD
(660)
Dementia
(109)
PDD
(100)
VaD
(105)
MIX
(15)
Clinical diagnosis
Fig. 1. Correlation between clinical and neuropathological diagnosis in 1050 consecutive autopsy cases of elderly individuals.
66
MMSE
CDR
Fig. 3. Column scatter plot of Braak stages vs. Clinical Dementia
Rating (CDR) scores in 100 oldest-old people (mean age at death
92.5 2.5 years).
4. Discussion
Several recent prospective and retrospective clinicopatholgical studies of elderly demented subjects found
average diagnostic accuracy rates between 43 and
100% (see [29,39]). However, the incidence of major
types of cerebral disorders causing cognitive decline
showed considerable variation, with considerable deviations between clinical and autopsy findings [1,7,18,
29,33,37,44,54]. The combination of the possible
67
Acknowledgements
The author tahnks the clinicians of Lainz Hospital
and of Otto Wagner Hospital, Vienna, Austria, for the
clinical data, Mrs. V. Rappelsberger for excellent laboratory work, and E-Mitter-Ferstl, PhD, for secretarial
and computer work. The study was partly supported
by the Society for Support of Research in Experimental
Neurology, Vienna, Austria.
68
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
I. Alafuzoff, K. Iqbal, H. Friden, R. Adolfsson and B. Winblad, Histopathological criteria for progressive dementia disorders: clinical-pathological correlation and classification by
multivariate data analysis, Acta Neuropathol (Berl) 74 (1987)
209-225.
H. Apaydin, J.E. Ahlskog, J.E. Parisi, B.F. Boeve and D.W.
Dickson, Parkinson disease neuropathology: later-developing
dementia and loss of the levodopa response, Arch Neurol 59
(2002), 102112.
J. Attems, F. Lintner and K.A. Jellinger, Amyloid beta peptide 1-42 highly correlates with capillary cerebral amyloid angiopathy and Alzheimer disease pathology, Acta Neuropathol
(Berl) 107 (2004), 283291.
C. Bancher, K. Jellinger, H. Lassmann, P. Fischer and F. Leblhuber, Correlations between mental state and quantitative neuropathology in the Vienna Longitudinal Study on Dementia,
Eur Arch Psychiatry Clin Neurosci 246 (1996), 137146.
L. Berg, D.W. McKeel Jr., J.P. Miller, J. Baty and J.C. Morris, Neuropathological indexes of Alzheimers disease in demented and nondemented persons aged 80 years and older,
Arch Neurol 50 (1993), 349358.
L. Berg, D.W. McKeel Jr., J.P. Miller, M. Storandt, E.H.
Rubin, J.C. Morris, J. Baty, M. Coats, J. Norton, A.M.
Goate, J.L. Price, M. Gearing, S.S. Mirra and A.M. Saunders, Clinicopathologic studies in cognitively healthy aging
and Alzheimers disease: relation of histologic markers to dementia severity, age, sex, and apolipoprotein E genotype, Arch
Neurol 55 (1998), 326335.
F. Boller, O.L. Lopez and J. Moossy, Diagnosis of dementia:
clinicopathologic correlations, Neurology 39 (1989), 7679.
J.V. Bowler, D.G. Munoz, H. Merskey and V. Hachinski,
Fallacies in the pathological confirmation of the diagnosis
of Alzheimers disease, J Neurol Neurosurg Psychiatry 64
(1998), 1824.
H. Braak and E. Braak, Neuropathological stageing of
Alzheimer-related changes, Acta Neuropathol (Berl) 82
(1991), 239259.
H. Braak, K. Del Tredici, U. Rub, R.A. de Vos, E.N. Jansen
Steur and E. Braak, Staging of brain pathology related to sporadic Parkinsons disease, Neurobiol Aging 24 (2003), 197
211.
H.C. Chui, J.I. Victoroff, D. Margolin, W. Jagust, R. Shankle,
and R. Katzman, Criteria for the diagnosis of ischemic vascular
dementia proposed by the State of California Alzheimers Disease Diagnostic and Treatment Centers, Neurology 42 (1992),
473480.
E.J. Cochran, J.A. Schneider, D.A. Bennett et al., Application
of NIA/Reagan Institute Working Group Criteria for diagnosis
of Alzheimers disease to members of the Religious Orders
Study (abstr.), J Neuropathol Exp Neurol 57 (1998), 508.
D.G. Davis, F.A. Schmitt, D.R. Wekstein and W.R. Markesbery, Alzheimer neuropathologic alterations in aged cognitively normal subjects, J Neuropathol Exp Neurol 58 (1999),
376388.
A. Delacourte, J.P. David, N. Sergeant, L. Buee, A. Wattez,
P. Vermersch, F. Ghozali, C. Fallet-Bianco, F. Pasquier, F.
Lebert, H. Petit and C. Di Menza, The biochemical pathway of
neurofibrillary degeneration in aging and Alzheimers disease,
Neurology 52 (1999), 11581165.
M. Emre, Dementia associated with Parkinsons disease,
Lancet Neurol 2 (2003), 229237.
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
M.S. Fernando and P.G. Ince, Vascular pathologies and cognition in a population-based cohort of elderly people, J Neurol
Sci 226 (2004), 1317.
F. Garcia-Sierra, J.J. Hauw, C. Duyckaerts, C.M. Wischik,
J. Luna-Munoz and R. Mena, The extent of neurofibrillary
pathology in perforant pathway neurons is the key determinant
of dementia in the very old, Acta Neuropathol (Berl) 100
(2000), 2935.
M. Gearing, S.S. Mirra, J.C. Hedreen, S.M. Sumi, L.A. Hansen
and A. Heyman, The Consortium to Establish a Registry for
Alzheimers Disease (CERAD), Part X: Neuropathology confirmation of the clinical diagnosis of Alzheimers disease, Neurology 45 (1995), 461466.
H.J. Gertz, J. Xuereb, F. Huppert, C. Brayne, M.A. McGee,
E. Paykel, C. Harrington, E. Mukaetova-Ladinska, T. Arendt
and C.M. Wischik, Examination of the validity of the hierarchical model of neuropathological staging in normal aging
and Alzheimers disease, Acta Neuropathol (Berl) 95 (1998),
154158.
G. Gold, P. Giannakopoulos, C. Montes-Paixao Junior, F.R.
Herrmann, R. Mulligan, J.P. Michel and C. Bouras, Sensitivity
and specificity of newly proposed clinical criteria for possible
vascular dementia, Neurology 49 (1997), 690694.
G. Gold, C. Bouras, E. Kovari, A. Canuto, B.G. Glaria, A.
Malky, P.R. Hof, J.P. Michel and P. Giannakopoulos, Clinical
validity of Braak neuropathological staging in the oldest-old,
Acta Neuropathol (Berl) 99 (2000), 579582.
E. Gomez-Tortosa, I. Gonzalo, S. Fanjul, M.J. Sainz, S.
Cantarero, C. Cemillan, J.G. Yebenes and T. del Ser, Cerebrospinal fluid markers in dementia with Lewy bodies compared with Alzheimer disease, Arch Neurol 60 (2003), 1218
1222.
J. Gunstad and J. Browndyke, Understanding incidence and
prevalence rates in mixed dementia, in: Vascular Dementia:
Cerebrovascular Mechanisms and Clinical Management, R.H.
Paul, R. Cohen, B.R. Ott and S. Salloway, eds, Human Press
Inc., Totowa, NJ, 2005, pp. 245255.
A.J. Harding and G.M. Halliday, Simplified neuropathological
diagnosis of dementia with Lewy bodies, Neuropathol Appl
Neurobiol 24 (1998), 195201.
A.J. Harding and G.M. Halliday, Cortical Lewy body pathology in the diagnosis of dementia, Acta Neuropathol (Berl) 102
(2001), 355363.
V. Haroutunian, D.P. Perl, D.P. Purohit, D. Marin, K. Khan,
M. Lantz, K.L. Davis and R.C. Mohs, Regional distribution
of neuritic plaques in the nondemented elderly and subjects
with very mild Alzheimer disease, Arch Neurol 55 (1998),
11851191.
B.T. Hyman and J.Q. Trojanowski, Consensus recommendations for the postmortem diagnosis of Alzheimer disease from
the National Institute on Aging and the Reagan Institute Working Group on diagnostic criteria for the neuropathological assessment of Alzheimer disease, J Neuropathol Exp Neurol 56
(1997), 10951097.
P.G. Ince, F.K. McArthur, E. Bjertness, A. Torvik, J.M. Candy
and J.A. Edwardson, Neuropathological diagnoses in elderly
patients in Oslo: Alzheimers disease, Lewy body disease,
vascular lesions, Dementia 6 (1995), 162168.
K. Jellinger, W. Danielczyk, P. Fischer and E. Gabriel, Clinicopathological analysis of dementia disorders in the elderly, J
Neurol Sci 95 (1990), 239258.
K.A. Jellinger, Clinical validity of Braak staging in the oldestold, Acta Neuropathol 99 (2000), 583584.
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
69
70
[61]
[62]
71
1. Introduction
One hundred years ago Alois Alzheimer described
neurofibrillary tangles in neocortical neurons in the dementing disease which now bears his name [2]. In 1961
when I set out to examine neocortical biopsies from
Alzheimers disease patients with the electron microscope I expected, like most people, that the neurofibrillary tangles would be composed of large numbers of
normal, or maybe thickened neurofilaments. Neurofilaments had been well described using the the electron
microscope by my old friend and teacher George Gray
with Rainer Guillery [7]. I was therefore surprised and
puzzled to find that the filaments of the tangle were
not neurofilaments but a new type of filament which I
called a paired helical filament (PHF) [10].
It is necessary here to go into some detail on the
subject of the recognition of cellular structures in the
electron microscope because of the subsequent disputes
as to the interpretation of the ultrastructural images of
these unusual filaments. In general, tissues of almost
any kind at some level of magnification show orienta Address for correspondence: Dr. M. Kidd, Anatomy, Department of Basic Medical Sciences, St Georges, University of London,
Cranmer Terrace, Tooting, London SW17 0RE, UK. Tel.: +44 0 20
8725 5207; Fax: +44 0 20 8725 3326; E-mail: mkidd@sgul.ac.uk.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
72
Fig. 1. Diagram showing the provenance of the irregular profiles seen in the EM when a PHF is viewed at various oblique angles, giving the
views drawn on the left panel of the diagram. The conventional eyeballs and broken lines represent different possible viewpoints at the indicated
angles of view. The observed projected images result from viewing one strand more transversely and the other more longitudinally. (From a
computer program).
(a)
73
(b)
Fig. 2. These diagrams are derived from Fig. 1, and show the two main types of profile seen when an obliquely-sectioned PHF lies in a thin
section.
Fig. 3. Electron micrograph of a PHF in a preparation from a macerated formalin-fixed post-mortem brain from a case of Alzheimers disease.
This shows a paired filamentous structure with intervening material, with some evidence of flattening from a true helical form.
Aaron Klug confirmed that these are paired helical filaments, and that the individual filaments of the pair
are L-shaped in transverse section. Crowther [5] also
found that the so-called straight filaments [9] consist of
the same two strands, but arranged differently so that
they appear to be a single filament at usual electron
microscopical resolutions.
In any event these abnormal structures are uniquely
twisted, and this serves to distinguish certain brain diseases from others, for example helps to distinguish
Alzheimer tangles from those in experimental aluminium myelo-encephalopathy [27]. The observations
reported in my 1963 letter to Nature [10] also showed
that these structures are present in neurites coursing
through the neuropil. These were later named neuropil
threads by Braak et al. [4], where they amplified my
observations and found an effective histological silver
staining method for these neurites. My 1964 Brain paper [11] also showed that these filaments are present
in neurites in the periphery of the the senile plaque. It
should be emphasised that none of these observations
could have been made if the PHFs were not recognisably different from normal neurofilaments. For example, the later identification of these tangle filaments as
an abnormal form of tau a microtubule-associated
protein could not have been made. I need not discuss
at length the further observations which derived from
my two publications since other papers in this volume
will cover this evidence.
I admit that I was disappointed when I became convinced by the ample literature that the PHFs are essentially tau protein with some form of abnormal phosphorylation [6,8,15,18,29,31]. It may be remembered
that, with some colleagues I suggested that the tangle
protein and A4 protein were the same [13]. As far
as I was concerned this was mainly on grounds of scientific economy, how could there be two different
amyloids in one head? Well it seems that there are
two since amyloid at the histological level seems to
be any filamentous protein that stains with Congo red
to give birefringence (usually in a beta-pleated sheet
form). This subject has been reviewed by Landon et
al. [17].
2. Hypothesis
Those helices in scattered neurites in the neuropil
consist of a more complete molecule than those of
the cell body and are therefore probably earlier in
date [16]. It is also interesting that the studies of the
1970s which showed tangles in remote places such as
the basal nucleus of Meynert [1] and in some of the
fourth ventricle nuclei [20] all suggest that the PHF material or influence travels centripetally from axon ending to perikaryon. In this context Braak & Braak [3]
(using conventional histological methods) suggest that
this process, whatever it is, starts chronologically in
74
Acknowledgements
I thank Dr. M.S. Pollanen and Dr. R.A. Crowther for
original photographs.
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
References
[21]
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
A. Hirano, H.M. Dembitzer, L.T. Kurland and H.M. Zimmerman, Fine structure of some intraganglionic inclusions, J
Neuropathol and Exp Neurol 27 (1968), 167182.
M. Kidd, Paired helical filaments in electron microscopy of
Alzheimers disease, Nature (Lond) 197 (1963), (4863) 192
193.
M. Kidd, Alzheimers disease: an electron microscopical
study, Brain 87 (1964), 307320.
M. Kidd, Fig 1 in Discussion of paper by Hirano A in
Alzheimers Disease Wolstenholme G E W & OConnor M
eds, Churchill (Lond) (1970), 203.
M. Kidd, D. Allsop and M. Landon, Senile plaque amyloid, paired helical filaments, and cerebrovascular amyloid
in Alzheimers disease are all deposits of the same protein,
Lancet 1(8423) (1985), 278278.
S.R. Korey, L. Scheinberg, R.D. Terry and A. Stern, Trans
Amer Neurol Assoc 86 (1961), 90.
K.S. Kosik, C.L. Joachim and D.J. Selkoe, Microtubuleassociated protein tau is a major antigenic component of paired
helical filaments in Alzheimer disease, Proc Natl Acad Sci
USA 83 (1986), 40444048.
M.A. Kurt, D.C. Davies and M. Kidd, Paired helical filament
morphology varies with intracellular location in Alzheimers
disease brain, Neuroscience Letters 239 (1997), 4144.
M. Landon, M. Kidd and D. Allsop, Amyloidosis with particular reference to cerebral amyloid in Alzheimers disease and
the transmissible subacute encephalopathies, Reviews in the
Neurosciences 1 (1987), 101126.
N. Nukina and Y. Ihara, One of the antigenic determinants of
paired helical filaments is related to tau protein, J Biochem
(Tokyo) 99 (1986), 15411554.
T.G. Ohm and H. Braak, Olfactory bulb changes in
Alzheimers disease, Acta Neuropathol 72 (1987), 365369.
R.C.A. Pearson, K.C. Gatter and T.P.S. Powell, The cortical
relationships of certain basal ganglia and the cholinergic basal
forebrain nuclei, Brain Research 26 (1983), 327330.
G. Perry, P. Mulvihill, V. Manetto, I. Autillio-Gambetti and
P. Gambetti, Immunocytochemical properties of Alzheimer
straight filaments, J Neuroscience 7 (1987), 37363738.
M.S. Pollanen, P. Marliewicz, M.C. Goh and C. Bergeron,
Alzheimer paired helical filaments: a comparison with the
twisted ribbon model, Acta Neuropathologica 90(2) (1995),
194197.
S.B. Prusiner, Prions, Sci Am 251 (1984), 5059.
R.D. Terry, Meeting of Amer Neuropathol Assoc (June, 1963).
R.D. Terry, The fine structure of neurofibrillary tangles in
Alzheimers disease, J Neuropathol Exp Neurol 22 (1963),
629641.
R.D. Terry, N.K. Gonatas and M. Weiss, Ultrastructural studies
in Alzheimers presenile dementia, Am J Pathol 44 (1964),
269287.
R.D. Terry and C. Pena, Experimental production of neurofibrillary degeneration. 2. Electron microscopy, phosphatase histochemistry and electron probe analysis, J Neuropathol Exp
Neurol 24 (1965), 200210.
C.M. Wischik, R.A. Crowther, M. Stewart and M. Roth, Subunit structure of paired helical filaments in Alzheimers disease, J Cell Biol 100 (1985), 19051912.
C.M. Wischik, M. Novak, H.C. Thorgersen, P.C. Edwards,
M.J. Runswick, R. Jakes, J.E. Walker, C. Milstein, M. Roth
and A. Klug, Isolation of a fragment of tau derived from the
core of the paired helical filament of Alzheimer disease, Proc
Nat Acad Sci USA (USA) 85(12) (1988), 45064510.
H.M. Wisniewski, H.K. Narang and R.D. Terry, Neurofibrillary tangles of paired helical filaments, J Neurol Sci 27 (1976),
173181.
[31] J.G. Wood, S.S. Mirra, N.J. Pollock and L.I. Binder, Neurofib-
75
rillary tangles of Alzheimer disease share antigenic determinants with the axonal microtubule-associated protein tau, Proc
Natl Acad Sci USA 83 (1986), 40404043.
Synaptic Changes
79
Keywords: Alzheimers disease, olfactory system, neocortex, cortical minicolumns, neural plasticity
1. Introduction
The Pearson et al. (1985) paper [73] was the
outcome of collaboration in Oxford between two
neuroanatomists (R.C.A. Pearson, T.P.S. Powell), a
neuropathologist (M.M. Esiri), a geriatrician (G.K.
Wilcock) and a statistician (R.W. Hiorns). A few years
previous, Drs. Wilcock and Esiri teamed up to try
to determine the feature of Alzheimers disease (AD)
Address for correspondence: Department of Neuropathology,
Radcliffe Infirmary, Oxford OX2 6HE, UK. Tel.: +44 1865 224403;
Fax: +44 1865 224508; E-mail: Margaret.esiri@clneuro.ox.ac.uk.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
80
81
82
83
has a diameter reflecting the tangential spread of afferent projections to the cortex of approximately 500800
microns [84]. Smaller still, at 5090 microns, is the
mini-column. NFT clustering occurs at a similar scale
to that of macro-column size. In a follow-up to the 1985
paper Hiorns et al. [47] observed that the distribution
of the cells of origin of ipsilateral cortico-cortical projections to a given cortical area were clustered in bands
of a similar size to macro-columns and a distribution
comparable to that of NFTs in AD.
Casanova [17] has anticipated that the spread of
neurofibrillary tangles (NFT) preferentially to corticopetal neurons causes clustering of the neurodegenerative changes which reflect modular structure.
The cells of a macro-column are selectively interconnected with those of other macro-columns which
share a similar stimulus sensitivity. The development
of NFT in neurons of layers III and V is consistent
with the spatial coincidence of supragranular and infragranular NFT clusters due to shared connectivity of
cells in the same macro-column. Consequently NFT
clustering may reflect the selective grouping of connections which is fundamental to columnar organization
(Fig. 2). However, the formation of columns also depends on the segregation of competing inputs and this
requires neuronal plasticity.
84
Fig. 1. (Left) Large pyramidal cells (outlined in white), can be used by minicolumn detection software (see ref. 16) to identify areas of high cell
concentration. (Middle) White lines depict the geometric minimum distance trees defining the cores of the minicolumns. (Right) Black lines
depict the boundaries of the areas of high cell concentration, used to compute minicolumn width and spacing.
85
Fig. 2. (Top) The purple, red and yellow glow of high neural plasticity is shown with its origin in olfactory areas of the medial and anterior
temporal cortex. Its spread seems to reflect the spread of AD pathology. (Bottom) The columnar organisation of connections and tangle
distribution in a cross-section of superior temporal association cortex is illustrated schematically. Layer III pyramidal cells sending feedforward
connections through the white matter (WM) are green, layer V pyramidal cells sending feedback connections are blue. Pink and yellow zones are
macrocolumns demonstrating selective connectivity to each other (pink connects to pink). Tangles (black filled cells) cluster in macrocolumns.
gic projections have the columnar dendritic morphology and electrophysiological properties of double bouquet cells [100]. This is a major class of calbindincontaining interneurons. We have found calbindin-cell
size is larger in subjects with larger minicolumns. High
immunoreactivity to calbindin is also found (in layers III and IV) at the borders of macro-columns and it
is thought to be associated with synaptic competition
on excitatory neurons [34]. Calbindin in neurons appears to be relatively protective in aging, but may be
lost as AD advances [42,52]. Therefore an interaction
between acetylcholine, calbindin cell inhibition, and
columnar organization in AD is plausible.
110
Minicolumn spacing
(m)
86
Planum
A1
MTG
100
90
80
70
60
25
50
75
100
Age (years)
11. Conclusion
The regional selectivity with respect to NFT formation shown by the cortex in AD is a core feature of
the disease and still lacks a full explanation. The most
adequate hypothesis to account for it is, in our opinion,
neuronal plasticity and the mechanisms that underlie it.
These are still in the process of being elucidated and
further enlightenment about AD can be expected to follow from increased insights into the nature of neuronal
plasticity. The hibernation model seems to us a valuable one to explore in this context. If neuronal plasticity provides the conditions needed to support NFT
formation there is no need to postulate any progressive
spread of an etiological agent.
The columnar distribution of NFT in association cortex in AD reflects the fate of mini- and macro-columns
with their integral contribution to cortical organization.
Methods of study that are sensitive to this organization
have more to contribute to an understanding both of
neuronal plasticity and of brain aging and AD.
The thinking behind the Pearson et al. paper [73]
was that neuroanatomical knowledge has much to contribute to an understanding of AD. In the intervening years neuroanatomists have continued to provide
significant insights about the disease. Are such contributions still relevant today? We think they are.
Transgenic animal models of AD show a non-uniform
anatomical distribution of pathology that needs interpretation in the light of neuroanatomical knowledge.
Neural plasticity, which we have suggested may have
an important role to play in the etiology of the disease, is regionally restricted and reflects neuroanatomical reality. And the dismantling of specific corticocortical connections, which determines the phenotypic
expression of the disease, can only be understood on
[16]
[17]
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
87
D. Buxhoeveden, A. Fobbs, E. Roy and M. Casanova, Quantitative comparison of radial cell columns in children with
Downs syndrome and controls, J Intellect Disabil Res 46
(2002), 7681.
M.F. Casanova, Modular concepts of brain organization and
the neuropathology of psychiatric conditions, Psychiatry Res
118 (2003), 101102.
S.A. Chance, M. Casanova, A.E. Switala, T.J. Crow and
M.M. Esiri, Minicolumn thinning in temporal lobe association cortex but not primary auditory cortex in normal human
ageing, Acta Neuropathologica (in press).
S.A. Chance, The ageing human brain: regional hierarchy of
subtle columnar changes, Nutrition and Health (in press).
S. Christen-Zaech, R. Kraftsik, O. Pillevuit, M. Kiraly, R.
Martins, K. Khalili and J. Miklossy, Early olfactory involvement in Alzheimers disease, Can J Neurol Sci 30 (2003),
2025.
J.A. Colombo, B. Quinn and V. Puissant, Disruption of astroglial interlaminar processes in Alzheimers disease, Brain
Res Bull 58 (2002), 235242.
D.H. Cribbs, B.Y. Azizeh, C.W. Cotman and F.M. LaFerla,
Fibril formation and neurotoxicity by a herpes simplex virus
glycoprotein B fragment with homology to the Alzheimers
A beta peptide, Biochemistry 39 (2000), 59885994.
L. Cruz, D.L. Roe, B. Urbanc, H. Cabral, H.E. Stanley and
D.L. Rosene, Age-related reduction in microcolumnar structure in area 46 of the rhesus monkey correlates with behavioral decline, Proc Natl Acad Sci USA 101 (2004), 15846
15851.
D.C. Davies, J.W. Brooks and D.A. Lewis, Axonal loss from
the olfactory tracts in Alzheimers disease, Neurobiol Aging
14 (1993), 353357.
M.C. De Lacoste and C.L. White, 3rd, The role of cortical
connectivity in Alzheimers disease pathogenesis: a review
and model system, Neurobiol Aging 14 (1993), 116.
F. Doetsch and R. Hen, Young and excitable: the function
of new neurons in the adult mammalian brain, Curr Opin
Neurobiol 15 (2005), 121128.
R.L. Doty, D.P. Perl, J.C. Steele, K.M. Chen, J.D. Pierce, Jr.,
P. Reyes and L.T. Kurland, Olfactory dysfunction in three
neurodegenerative diseases, Geriatrics 46(1) (1991), 4751.
G.N. Elston and M.G. Rosa, Pyramidal cells, patches, and
cortical columns: a comparative study of infragranular neurons in TEO, TE, and the superior temporal polysensory area
of the macaque monkey, J Neurosci 20 (2000), RC117.
M.M. Esiri, Herpes simplex encephalitis. An immunohistological study of the distribution of viral antigen within the
brain, J Neurol Sci 54 (1982), 209226.
M.M. Esiri, R.C. Pearson, J.E. Steele, D.M. Bowen and T.P.
Powell, A quantitative study of the neurofibrillary tangles and
the choline acetyltransferase activity in the cerebral cortex
and the amygdala in Alzheimers disease, J Neurol Neurosurg
Psychiatry 53 (1990), 161165.
M.M. Esiri and G.K. Wilcock, The olfactory bulbs in
Alzheimers disease, J Neurol Neurosurg Psychiatry 47
(1984), 5660.
M.M. Esiri and G.K. Wilcock, Cerebral amyloid angiopathy
in dementia and old age, J Neurol Neurosurg Psychiatry 49
(1986), 12211226.
J.I. Feldman, C. Murphy, T.M. Davidson, A.A. Jalowayski
and G.G. de Jaime, The rhinologic evaluation of Alzheimers
disease, Laryngoscope 101 (1991), 11981202.
88
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[72]
[73]
[74]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
89
D.J. Selkoe, Cell biology of the amyloid beta-protein precursor and the mechanism of Alzheimers disease, Annu Rev
Cell Biol 10 (1994), 373403.
R.G. Struble and H.B. Clark, Olfactory bulb lesions in
Alzheimers disease, Neurobiol Aging 13 (1992), 469473.
M. Tabaton, S. Cammarata, G.L. Mancardi, G. Cordone, G.
Perry and C. Loeb, Abnormal tau-reactive filaments in olfactory mucosa in biopsy specimens of patients with probable
Alzheimers disease, Neurology 41 (1991), 391394.
B.R. Talamo, R. Rudel, K.S. Kosik, V.M. Lee, S. Neff, L.
Adelman and J.S. Kauer, Pathological changes in olfactory
neurons in patients with Alzheimers disease, Nature 337
(1989), 736739.
M.D. Thompson, K. Knee and C.J. Golden, Olfaction in persons with Alzheimers disease, Neuropsychol Rev 8 (1998),
1123.
A.H. Tomlinson and M.M. Esiri, Herpes simplex encephalitis. Immunohistological demonstration of spread of virus via
olfactory pathways in mice, J Neurol Sci 60 (1983), 473484.
J.Q. Trojanowski, P.D. Newman, W.D. Hill and V.M. Lee,
Human olfactory epithelium in normal aging, Alzheimers
disease, and other neurodegenerative disorders, J Comp Neurol 310 (1991), 365376.
Y. Tsuboi, Z.K. Wszolek, N.R. Graff-Radford, N. Cookson
and D.W. Dickson, Tau pathology in the olfactory bulb correlates with Braak stage, Lewy body pathology and apolipoprotein epsilon4, Neuropathol Appl Neurobiol 29 (2003), 503
510.
I. Vincent, M. Rosado and P. Davies, Mitotic mechanisms in
Alzheimers disease? J Cell Biol 132 (1996), 413425.
E.K. Wagner and D.C. Bloom, Experimental investigation of
herpes simplex virus latency, Clin Microbiol Rev 10 (1997),
419443.
H.Y. Wang, D.H. Lee, C.B. Davis and R.P. Shank, Amyloid peptide Abeta(142) binds selectively and with picomolar affinity to alpha7 nicotinic acetylcholine receptors, J
Neurochem 75 (2000), 11551161.
G.K. Wilcock and M.M. Esiri, Plaques, tangles and dementia.
A quantitative study, J Neurol Sci 56 (1982), 343356.
N.J. Woolf, Global and serial neurons form A hierarchically
arranged interface proposed to underlie memory and cognition, Neuroscience 74 (1996), 625651.
Z.K. Wszolek and K. Markopoulou, Olfactory dysfunction
in Parkinsons disease, Clin Neurosci 5 (1998), 94101.
Z.J. Wynn and J.L. Cummings, Cholinesterase inhibitor therapies and neuropsychiatric manifestations of Alzheimers
disease, Dement Geriatr Cogn Disord 17 (2004), 100108.
Z. Xiang, J.R. Huguenard and D.A. Prince, Cholinergic
switching within neocortical inhibitory networks, Science
281 (1998), 985988.
91
1. Introduction
Since the seminal contribution by Alois Alzheimer
in 1907 [2], considerable progress has been made in
understanding the pathogenesis and etiology of this
devastating neurological condition. Because familial Alzheimers disease (AD) is associated with mutations within the amyloid -protein precursor (APP)
gene [32,39,104] or the -secretase complex [101], a
regulator of amyloid protein (A) production, most
studies have focused at understanding the role of A
protein in the mechanisms of neuronal damage and
neurodegeneration. However, several lines of evidence
suggest that although the amyloid deposits and the
plaques are useful diagnostic markers, they are not the
best correlate to the neuronal damage and cognitive alterations. In fact, we, as well as several other groups,
have found that synaptic damage is an early pathologi Corresponding author: Dr. E. Masliah, Department of Neurosciences, University of California, San Diego, La Jolla, CA 920930624, USA. Tel.: 858 534 8992; Fax: 858 534 6232; E-mail:
emasliah@ucsd.edu.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
92
than part of the aging process [94]. Both studies in experimental animal models as well as in the aging human
brain have shown some variability in the results and degree of synapse decline that might correlate with learning deficits [30,86]. Several technical factors might
explain the variability observed among various groups,
including age range and distribution of samples, homogeneity of brain regions, gender, sampling strategy and
method to estimate synapse numbers [94]. However, it
is likely that independently of the differences observed
by these studies, subtle changes in synaptic functioning
and morphology occur during aging that might account
for the cognitive decline [73]. A promising direction
to investigate such changes in real time is the recent
development of transgenic (tg) animal models expressing green fluorescent protein (GFP) and GFP-tagged
synaptic and dendritic molecules such as postsynaptic
density protein-95 (PSD95), synaptophysin and others
that allow imaging of synapses and spines over a period of time using two-photon microscopy laser technology. Recent reports in this direction using GFPtagged neurons in mice have shown that a fraction of
persistent spines grew gradually during development
until adulthood. At 6 months of age spines turn over
more slowly, possibly reflecting differences in capacity
for experience-dependent plasticity [44].
The functional and structural stability of the CNS
microcircuitries during aging depends on the stability of the circuitries [42] and on the neuronal capacity to exchange information across the synaptic junction [24]. Neurons generate complex patterns of synaptic interconnectivity that exhibit a remarkable plasticity both during development and adulthood [85].
Synaptic functioning depends on the patterns of synaptic plasticity and density. Synaptic density might depend on synaptic pruning, synaptogenesis, synapse
remodeling and spine dynamics, among others [42].
Furthermore, synapse density might depend on the
balance between factors promoting synapse pruning
and sprouting. During the aging process, decline in
spine activity, decreased synaptosomal membrane fluidity [15], increased synapse pruning and reduced expression, and oxidative alterations in cytoskeletal, signaling and vesicle molecules might be responsible for
the decreased synaptic function. Other factors mediating synapse and spine stability include expression
and activity of calcium dependent proteolytic enzymes
such as calpain. On the other hand, decreased activity of regulatory mechanisms involved in remodeling
and sprouting, including deficient expression of growth
factors, signaling pathways involved or molecules such
93
Fig. 1. Synaptic loss and sprouting during aging and in AD. (A) Diagrammatic representation of trends in synapse populations during aging and
AD. (B) Presynaptic boutons in aged brain identified by laser scanning confocal microscopy of synaptophysin-labeled sections. (C) Synapses in
aged brain visualized by electron microscopy. Bar = 35 m (B), 15 m (C).
20,108]. This sequence of events is consistent with experimental studies in the aged macaque [61] and in tg
models of AD where synaptic loss and memory deficits
precede amyloid deposition and plaque formation, but
are associated with increased production of A 142 in
the limbic system [63,84].
Thus, the dementia in AD is associated with the disruption of neuritic substructure and loss of synaptic
contacts in specific cortical and subcortical areas [41].
The damage to these circuitries in early stages of AD
results in memory loss followed by attention deficits,
judgment impairments, mood changes, confusion and
inability to maintain purposeful thinking [76]. Cases
displaying clinical and neuropathological features of
early or incipient AD showed a significant 20% loss of
synapses in the outer molecular layer of the hippocampal DG [90,112]. Cases presenting with more severe
disease showed a progressively more significant loss
of synapses in the neocortex, as well as in the outer
molecular layer of the hippocampal DG [62]. Further supporting these findings, measurements by electron microscopy and immunohistochemistry have both
shown very strong correlations between synaptic numbers in the frontal cortex and tests of global cognition
in AD [9,20,57,114]. These findings have been confirmed by immunochemical quantification of various
synaptic proteins [114,118]. For example, the levels of
the synaptic-like marker EP10 in all cortical areas and
the hippocampus were correlated (p < 0.05 0.01)
with the Blessed test, but not with the Object Memory
Examination [21]. The concomitant atrophy and loss of
dendritic spines in AD also contributes to the severity
of dementia [3,8].
Ultrastructural analyses have shown a highly significant AD-related decline in synaptic numbers in lamina III and V in both superior and middle temporal
gyrus [92] and cingulate cortex [94]. There were no
correlations between synaptic density and synaptic apposition length or density of senile plaques [92]. In
contrast, in the EC no change in synaptic density was
94
Fig. 2. Progressive synapse loss in AD. (A-D) Representative images of synaptic integrity in a non-demented control (A) and progressive synapse
loss in early (B), intermediate (C) and advanced (D) AD. (E) Mechanisms involved in amyloid-mediated synapse loss in AD. Bar = 20 m.
95
and molecular mechanisms involved. Several possibilities have been postulated, among them, some studies
suggest that increased lysosomal leakage, increased intracellular trafficking of calcium, accumulation of intracellular A in the synapse [103], reduced synaptic
vesicle trafficking [12,116], deficient axonal transport,
abnormal activation of signaling pathways and activation of caspases at the synapse terminal [81,82] might
play a role in the mechanisms of synapse loss mediated
by A oligomerization. More recently, several lines
of investigation have provided additional data suggesting that A oligomers rather than fibrils [113] might
directly damage synapses probably via activation of
Fyn [14] and alterations in the expression of the synaptic plasticity associated molecule the activity-regulated
cytoskeletal-associated protein (Arc) [55].
In conclusion, it is likely that either in combination
or by themselves, these mechanisms might play an important role at the various stages of the neurodegenerative process in AD and they might represent attractive
targets for future drug development.
Acknowledgments
This work was supported by NIH Grants AG18440,
AG5131 and AG022074.
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
96
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
P. Hof and J. Morrison, The cellular basis of cortical disconnection in Alzheimer disease and related dementing conditions, in: Alzheimer disease, R. Terry, R. Katzman and K.
Bick, eds, Raven Press, New York, 1994, pp. 197230.
P.R. Hof and J.H. Morrison, The aging brain: morphomolecular senescence of cortical circuits, Trends Neurosci 27
(2004), 607613.
R.M. Holsinger, C.A. McLean, K. Beyreuther, C.L. Masters
and G. Evin, Increased expression of the amyloid precursor
-secretase in Alzheimers disease, Ann Neurol 51 (2002),
783786.
A.J. Holtmaat, J.T. Trachtenberg, L. Wilbrecht, G.M. Shepherd, X. Zhang, G.W. Knott and K. Svoboda, Transient and
persistent dendritic spines in the neocortex in vivo, Neuron
45 (2005), 279291.
J.T. Huse, K. Liu, D.S. Pijak, D. Carlin, V.M. Lee and R.W.
Doms, -secretase processing in the trans-Golgi network
preferentially generates truncated amyloid species that accumulate in Alzheimers disease brain, J Biol Chem 277 (2002),
1627816284.
P. Huttenlocher, Synaptic density in human frontal cortex
developmental changes and effects of aging, Brain Res 163
(1979), 195205.
B. Hyman, G. Van Hoesen, L. Kromer and A. Damasio,
Perforant pathway changes in the memory impairment of
Alzheimers disease, Ann. Neurol. 20 (1986), 472481.
D. Jones and R. Harris, An analysis of contemporary morphological concepts of synaptic remodelling in the CNS: Perforated synapses revisited, Rev. Neurosci. 6 (1995), 177219.
F. Kamenetz, T. Tomita, H. Hsieh, G. Seabrook, D. Borchelt,
T. Iwatsubo, S. Sisodia and R. Malinow, APP Processing and
synaptic function, Neuron 37 (2003), 925937.
R. Katzman, Alzheimers disease is a degenerative disorder,
Neurobiol. Aging 10 (1989), 581582588590.
Z. Khachaturian, Diagnosis of Alzheimers disease, Arch.
Neurol. 42 (1985), 10971105.
W.L. Klein, A toxicity in Alzheimers disease: globular
oligomers (ADDLs) as new vaccine and drug targets, Neurochem Int 41 (2002), 345352.
E. Koo, P.J. Lansbury and J. Kelly, Amyloid diseases: Abnormal protein aggregation in neurodegeneration, Proc. Natl.
Acad. Sci. USA 96 (1999), 99899990.
E. Koo, L. Park and D. Selkoe, Amyloid -protein as a substrate interacts with extracellular matrix to promote neurite
outgrowth, Proc. Natl. Acad. Sci. USA 90 (1993), 47494752.
P.N. Lacor, M.C. Buniel, L. Chang, S.J. Fernandez, Y. Gong,
K.L. Viola, M.P. Lambert, P.T. Velasco, E.H. Bigio, C.E.
Finch, G.A. Krafft and W.L. Klein, Synaptic targeting by
Alzheimers-related amyloid oligomers, J Neurosci 24
(2004), 1019110200.
H.A. Lashuel, D.M. Hartley, B.M. Petre, J.S. Wall, M.N.
Simon, T. Walz and P.T. Lansbury, Jr., Mixtures of wild-type
and a pathogenic (E22G) form of A40 in vitro accumulate
protofibrils, including amyloid pores, J Mol Biol 332 (2003),
795808.
H. Lassmann, R. Weiler, P. Fischer, C. Bancher, K. Jellinger,
E. Floor, W. Danielczyk, F. Seitelberger and H. Winkler,
Synaptic pathology in Alzheimers disease: immunological
data for markers of synaptic and large dense-core vesicles,
Neurosci 46 (1992), 18.
H.G. Lee, P.I. Moreira, X. Zhu, M.A. Smith and G. Perry,
Staying connected: synapses in Alzheimer disease, Am J
Pathol 165 (2004), 14611464.
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[74]
[75]
97
98
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]
[102]
[103]
[104]
[105]
[106]
[107]
[108]
[109]
[110]
[111]
[112]
[113]
[114]
[115]
[116]
[117]
[118]
99
101
1. Introduction
The prevalence of neuropathology such as senile
plaques (SP) and neurofibrillary tangles (NFT) not
only in the neocortex but also the hippocampus and
other limbic structures has been the driving force for a
plethora of research in AD. The progressive decline in
cognitive function has been strongly associated with the
presence of increased incidence of this neuropathology
beginning with the original work by Blessed et al. [8]
and the excellent work by Braak and Braak [912].
Numerous studies have now shown that non-demented
elderly individuals can manifest significant numbers of
these neuropathologic lesions in the cerebral cortex,
suggesting that SP and NFT may be a feature of normal brain aging [4,16,18,28,39,43,44,65,75,91]. What
Corresponding author: Stephen W. Scheff, Sanders-Brown Center on Aging, Room 101 Sanders-Brown, University of Kentucky,
Lexington, KY 40536-0230, USA. Tel.: +1 859 257 1412 ext 270;
Fax: +1 859 323 2866; E-mail: sscheff@email.uky.edu.
differentiates AD from normal aging is the early subtle impairment in cognitive function. These individuals lose their ability to store recent information, which
subsequently has devastating consequences for every
day living. There is now accumulating evidence that
the reason for the progressive cognitive decline is a loss
of synapses resulting in a disruption of corticocortical
connectivity. The present review examines the ultrastructural studies that support the synaptic loss hypothesis of AD.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
102
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
103
Fig. 1. Numerical synaptic density in the superior frontal cortex, Brodmann area 9, was determined for subjects of different age at the time of
death. A minimum of five subjects were evaluated for each decade of life beginning at age 20. All subjects are believed to have been cognitively
normal prior to death. Synaptic density was determined in both lamina III and V of the cortex using transmission electron microscopy. Dashed
lines indicate the overall mean for each lamina. Bars represent group mean and standard deviation. (see [84] for details).
vious that not only did the tissue need to come from
short PMI subjects, but also that the groups needed to
be matched in terms of age. All of the AD subjects
had been closely followed in the clinic and met the
NINCDS-NIA clinical criteria for probable AD [63]
and pathological criteria for tissue diagnosis of AD as
well [45]. All of the AD subjects were considered to be
end-stage with an average illness duration of 8 years.
The control subjects were obtained from the normal
autopsy service at the university hospital and retrospective review of medical charts were gleaned to determine whether or not there was any clinical history of
neurological or psychiatric disease. As the ADRC began to expand its patient base to include non-demented
elderly individuals, relevant clinical neurological data
was available. Since we limited the PMI to a maximum of 13 h, and the average PMI was 78 hours, the
quality of the tissue was quite good and the identification of synapses with transmission EM was acceptable
(Fig. 2).
Although the same individuals acquired tissue at
each of the autopsies, the number of samples taken from
any given region was limited and certainly didnt represent the entire Brodmann region. This is important because consequently we could not apply all the rules of
unbiased stereology. A minimum of three tissue blocks
per region were taken from each subject and 15 disectors were evaluated from this tissue. From these samples the number of synapses per mm 3 was calculated.
The findings from this initial set of experiments were
better than expected. The detailed analysis revealed a
highly significant 42% loss of synapses in lamina III
104
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
Fig. 3. Individuals were administered a test of overall cognitive function, Mini-Mental Status Exam (MMSE), shortly before undergoing
a biopsy of the superior frontal cortex. The results showed a significant (r = +0.772) correlation with the synaptic packing density observed in lamina III of the superior frontal cortex (Brodmann area 9).
The results suggest that loss of synaptic connectivity in this region
is reflected by lower scores on the MMSE, indicative of a decline
in cognitive function. The open circles represent individual patient
scores and synaptic density. p < 0.01.
Fig. 2. Electron micrographs of human middle temporal gyrus (lamina III) 8 h postmortem are shown. Micrograph A is from one of the
non-demented control subjects and the micrograph in B is from an
end-stage Alzheimer subject that is age-matched. Asterisks indicate
some of the synaptic complexes that are clearly visible in these samples and demonstrate the quality of the tissue that was routinely used
in the ultrastructural studies. Calibration bar = 1 m.
and a 29% loss in laminae V, very similar to results reported earlier [17]. We failed to detect any age-related
change in synaptic density in either the non-demented
control group or the AD group similar to the findings
from our more extensive normal aging study [84]. A
regression analysis also failed to show any relationship
between the laminar width and the synaptic density ruling out atrophy as a mechanism to increase packing
density in the control subjects. The significant ADrelated synaptic decline observed in both laminae supported the previously published IHC reports, although
the overall magnitude of the decline appeared to be
greater with the synaptophysin antibody [58]. Nevertheless, the ultrastructural studies and the IHC results
agreed that during the course of the disease, the frontal
cortex failed to maintain the normal compliment of
synapses.
One question that was heavily discussed in our group
concerned how early in the course of the disease was the
cortical circuitry altered as a result of a loss of significant synaptic numbers and was the decline in synapses
responsible for the progressive cognitive decline that
was the behavioral hallmark of the disease. We were
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
105
106
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
Fig. 4. Alzheimer related changes in the density of synapses in various regions of the neocortex. Values are plotted as a percent change of the
mean value of age- and PMI-matched control group. All tissue was obtained within 13 h postmortem and represents end-stage of the disease.
The entorhinal cortex (Brodmann area 28) failed to show any significant loss for either lamina III or V. Lamina V of the anterior cingulated region
(Brodmann area 24) also failed to show any disease-related loss of synaptic density. Open bars represent lamina III and shaded bars represent
lamina V. Bars represent group means with standard deviation and was calculated from a minimum of 9 Alzheimer subjects. # p < 0.05, p <
0.01.
Fig. 5. Many of the same subjects analyzed for possible changes in synaptic numbers in the superior frontal cortex (Brodmann area 9) were
also assessed for possible changes in the middle temporal (Brodmann 21) and superior temporal (Brodmann 22) cortical regions. When both
non-demented control subjects and AD subjects are combined, both cortical regions show a strong correlation with the values obtained in Area
9. In A the results are shown for lamina III and in B the results for lamina V are displayed. For both cortical regions the relationship with Area
9 is almost identical. However, when only the AD cases are analyzed the correlation is no longer significant. Each of the symbols represents an
individuals synaptic density for each area. p < 0.01.
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
with the AD subjects having an average of 9 year illness duration indicative of end-stage of the disease.
Most of the control cases were from individuals that
had been followed by the UK-ADRC and were recently
cognitively tested. The brains of the AD subjects contained abundant SP and NFT in the hippocampus and
neorcortical regions. Cortical samples were taken from
both the anterior and posterior regions of the cingulate in each subject and great care was used to ensure
that the same region was assessed between subjects and
groups. As we discovered later, this was a fortunate
decision since we were unaware of the heterogeneity
of this brain region and its diverse connectivity. Laminae III and V were examined in order that the results
could be compared and contrasted with previous results. Both the anterior and posterior cingulated cortex
demonstrated significant loss of synaptic numbers in
AD [81]. The posterior cingulate gyrus demonstrated
greater loss in both lamina III (24%) and lamina V
(33%) compared to the anterior cingulate in the AD
group. Surprisingly, the anterior cingulate region only
showed a loss in lamina III (20%) and no decline in
lamina V (Fig. 4). This lack of synaptic loss in area 24
was extremely puzzling and we initially attributed it to
a possible basic difference in afferents to this area [101,
102]. We subsequently learned that the portion of the
cingulate gyrus used in this investigation, the caudal anterior cingulate, connects to several supplemental motor regions and plays a role in motor activities. Numerous morphological studies have demonstrated that both
motor and primary sensory areas are the least affected
in AD and the involvement of area 24 in this motor
system may be directly related to the maintenance of
synapses. Synaptophysin IHC has also demonstrated a
loss in the posterior cingulate with values considerably
greater than we obtained [54]. A chemical analysis
of synapsin I levels, a neuron-specific synaptic vesicle
phosphoprotein, failed to show any AD-related change
in the cingulated cortex [70]. Correlations between
the two cingulate areas were similar to that found in
the temporal lobe. While there was a positive trend
in the data, neither region could be used to predict the
response of the other.
Several early studies had reported significant loss of
synaptophysin staining (4457%) in the inferior parietal cortex (Brodmann area 3940) [54,58,59,97]. This
neocortical region is known to be heavily involved in
AD and has been implicated in significant oxidative
damage [15,49]. The inferior parietal region is a multimodal association area intimately involved in language comprehension rather than language expression.
107
108
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
Fig. 6. Synaptic density measurements determined by quantitative ultrastructural analysis in the inferior parietal lobule (Brodmann area 39/40)
and the inferior temporal lobule (Brodmann area 20). Both laminae III and V in each of the two cortical regions of the Alzheimer group (stripped
bars) showed a significant decline in synaptic numbers compared to age- and postmortem-matched non-demented controls (open bars). Bars
represent group means with standard deviation p < 0.05; p < 0.01.
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
109
tic measurements to determine the total synaptic contact area (TSCA) in each of the regions that were investigated and subsequently compared the AD and nondemented control groups. The results of the analysis
were surprising. For many of the areas, the increase in
the synaptic size off set the significant loss of synapses
in terms of the TSCA (Table 1). Only two areas that
manifested a significant increase in synaptic size (area
9 lamina III; area 22 lamina III) was their a failure to
restore TSCA. In two other areas (Brodmann 20 and
39/40) there was no significant change in synaptic size
and consequently the TSCA was significantly reduced.
This may indicate that these neocortical areas have lost
a significant amount of their plasticity potential during
the progressive course of the disease. The failure to
completely restore TSCA in area 9 in end-stage subjects is in contrast to the biopsy data from early AD
subjects that does demonstrate a restoration of TSCA.
We have previously proposed a model that might help
to interpret the importance of the synaptic enlargement
and TSCA in AD [83]. In this model, target neurons
strive to maintain a set level of contacts and they do
so by monitoring the overall level of synaptic contact.
As inputs decline, the target neurons signal the need
for new afferents to replace those lost. As part of the
compensatory process, remaining afferents enlarge and
subsequently reduce the strength of the signal of the
target neuron. Maximal denervation would generate
the strongest signal in an attempt to attract synaptic
contact. In end-stage of the disease process, some areas of the AD brain are more involved than others. In
these regions one would expect to see preserved TSCA
perhaps early in the disease and subsequently a failure to maintain TSCA later, such as in area 9. As the
disease progresses not only do the target neurons fail
to initiate and maintain a strong attracting signal, but
afferents also fail to launch a compensatory response
(increase in synapse size). The overall effect is a loss
of synaptic density coupled with a decline in baseline
TSCA. It is extremely interesting that the two regions
that demonstrated a failed compensatory response were
areas known to be affected early in the disease and areas with the smallest synapses of all the regions investigated.
110
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
Fig. 8. Relationship between synaptic apposition length and the numerical density of synapses in different regions of the neocortex and
hippocampus is displayed. Graphs are representative of the findings in both lamina III () and V () for the Alzheimer group. As the density of
synapses in the different cortical regions declined, the size of the apposition length of the residual synapses enlarged. This may be a compensatory
mechanism used by the different cortical structures to maintain total synaptic contact area. Lines represent simple regression analysis.
insoluble amyloid- (A) and that the progressive accumulation of A triggers neuronal and synaptic abnormalities associated with AD. The key biochemical
component of the AD plaque is fibrillar amyloid beta
protein that is an end product of the processing of the
APP, a protein that may play an important role in
synaptic activity and cell adhesion. Early in our investigations of synaptic change in AD we stained tissue
adjacent to that used for ultrastructural study and subsequently counted the number of SP and attempted to
correlate it to the synaptic counts. Individual counts
were made for both lamina III and V. In every area studied the number of plaques was significantly greater than
in the non-demented controls. However, the number of
plaques failed to demonstrate any significant relationship to synaptic numbers in either lamina [79,80,84].
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
111
Table 1
Change in total synaptic contact area (TSCA) in Alzheimers disease
Region studied
Area 9
Lamina III
Lamina III (Biopsy)
Lamina V
Area 20
Lamina III
Lamina V
Area 21
Lamina III
Lamina V
Area 22
Lamina III
Lamina V
Area 23
Lamina III
Lamina V
Area 24
Lamina III
Lamina V
Area 39/40
Lamina III
Lamina V
Hippocampus
OML
IML
% Synaptic change
% Apposition change
% TSCA change
42
35
29
+ 23
+ 28
+ 20
11
+5
+2
31
29
+5
+3
26
17
33
23
+ 22
+ 15
+3
0
32
29
+ 16
+ 19
9
+5
23
33
+ 17
+ 23
+7
1
20
+3
+ 29
+2
+ 28
+ 10
25
30
4
1
27
30
21
15
+ 18
+ 12
+4
+4
112
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
mented the loss and reacquisition of these morphological structures under conditions as simple as hormonal
change, stress, and learning [61,62]. Aging in the nervous system does not necessary result in a loss of neurons or neuronal connectivity as evidenced by our results assessing synaptic density in the frontal cortex.
These results amplify the devastating consequences observed in AD. Even early in the disease process the
frontal association cortex is significantly altered and
must contribute to the decline in the individuals cognitive ability. The ability to attend to a stimulus and subsequently determine the merit of that stimulus requires
that multiple associational areas of the cortex work in
concert. The ability to store important information and
to recall that information also requires that multiple
regions of the brain work together. The progressive
cognitive decline observed in AD most likely reflects
an anatomical disruption in the cooperation of various
regions of the CNS. Our ultrastructural studies over the
last decade and a half have documented the decline of
cortical connectivity in multiple association regions of
the neocortex and portions of the hippocampus. Clearly
the nervous system tries to respond to the impending
loss of the connectivity but the compensatory response
appears to ultimately fail with progression of the disease. The challenge is to isolate the mechanism(s) underlying this loss of connectivity early in the disease
process and to mount a therapeutic regime that halts
the synaptic loss and encourages synaptogenesis. Even
with a replacement of synaptic numbers it is unclear
that the most appropriate connectivity will be made and
that the ravished nervous system will be able to incorporate an altered circuitry to carry out its complicated
tasks. It is important that we attempt to make headway
in this regard and probe the underlying resilience of the
nervous system.
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
Acknowledgements
This research was supported by the National Institute of Health grants AG05144, AG05119, AG12138,
AG12986 and AG14449, and the Alzheimers Association.
[16]
[17]
References
[18]
[1]
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
113
114
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
J.E. Lisman and K.M. Harris, Quantal analysis and synaptic
anatomy integrating two views of hippocampal plasticity,
Trends Neurosci 16 (1993), 141147.
X. Liu and A. Brun, Synaptophysin immunoreactivity is stable 36 h postmortem, Dementia 6 (1995), 211217.
X. Liu, C. Erikson and A. Brun, Cortical synaptic changes
and gliosis in normal aging, Alzheimers disease and frontal
lobe degeneration, Dementia 7 (1996), 128134.
L.F. Lue, Y.M. Kuo, A.E. Roher, L. Brachova, Y. Shen, L.
Sue, T. Beach, J.H. Kurth, R.E. Rydel and J. Rogers, Soluble
amyloid beta peptide concentration as a predictor of synaptic
change in Alzheimers disease, Am J Pathol 155 (1999), 853
862.
W.R. Markesbery and J.M. Carney, Oxidative alterations in
Alzheimers disease, Brain Pathol 9 (1999), 133146.
E. Masliah, M. Mallory, L. Hansen, R. DeTeresa and R.D.
Terry, Quantitative synaptic alterations in the human neocortex during normal aging, Neurology 43 (1993), 192197.
E. Masliah, R. Terry, R. DeTeresa and L. Hansen, Immunohistochemical quantification of the synapse-related protein synaptophysin in Alzheimer disease, Neurosci Lett 103
(1989), 234239.
E. Masliah, R.D. Terry, M. Alford, R. DeTeresa and L.A.
Hansen, Cortical and subcortical patterns of synaptophysinlike immunoreactivity in Alzheimers disease, Am J Pathol
138 (1991), 235246.
E. Masliah, R.D. Terry, M. Mallory, M. Alford and L.A.
Hansen, Diffuse plaques do not accentuate synapse loss in
Alzheimers disease, Am J Pathol 137 (1990), 12931297.
B. McEwen, K. Akama, S. Alves, W.G. Brake, K. Bulloch,
S. Lee, C. Li, G. Yuen and T.A. Milner, Tracking the estrogen receptor in neurons: implications for estrogen-induced
synapse formation, Proc Natl Acad Sci USA 98 (2001), 7093
7100.
B.S. McEwen and A.M. Magarinos, Stress and hippocampal
plasticity: implications for the pathophysiology of affective
disorders, Hum Psychopharmacol 16 (2001), S7S19.
G. McKhann, D. Drachman, M. Folstein and D. Katzman,
Clinical diagnosis of Alzheimers disease, Neurology 34
(1984), 939944.
S. Minoshima, B. Giordani, S. Berent, K.A. Frey, N.L. Foster
and D.E. Kuhl, Metabolic reduction in the posterior cingulate
cortex in very early Alzheimers disease, Ann Neurol 42
(1997), 8594.
J.C. Morris, M. Storandt, S.W. McKeel, E.H. Rubin, J.L.
Price, E.A. Grant and L. Berg, Cerebral amyloid deposition and diffuse plaques in normal aging: Evidence for
presymptomatic and very mild Alzheimers disease, Neurology 46 (1996), 707719.
L. Mucke, E. Masliah, G.Q. Yu, M. Mallory, E.M. Rockenstein, G. Tatsuno, K. Hu, D. Kholodenko, K. JohnsonWood and L. McConlogue, High-level neuronal expression
of A beta 142 in wild-type human amyloid protein precursor
transgenic mice: synaptotoxicity without plaque formation,
J Neurosci 20 (2000), 40504058.
A. Nunomura, G. Perry, G. Aliev, K. Hirai, A. Takeda, E.K.
Balraj, P.K. Jones, H. Ghanbari, T. Wataya, S. Shimohama,
S. Chiba, C.S. Atwood, R.B. Petersen and M.A. Smith, Oxidative damage is the earliest event in Alzheimer disease, J
Neuropathol Exp Neurol 60 (2001), 759767.
B. Pakkenberg and J.G. Gundersen, Neocortical neuron number in humans: effect of sex and age, J Comp Neurol 384
(1997), 312320.
[69]
[70]
[71]
[72]
[73]
[74]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
S.W. Scheff and D.A. Price / Alzheimers disease-related alterations in synaptic density: Neocortex and hippocampus
[87]
[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]
[102]
[103]
[104]
[105]
115
117
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
118
In about 1976, Peter Davies, working in Edinborough, reported that choline acetyl transferase (ChAT)
was significantly depressed in Alzheimer cortex [2].
Peter was readily persuaded to join us in New York,
where we pursued the cholinergic aspects and other
chemical abnormalities including the deficiency of somatostatin [3].
The cholinergic findings opened the field to the pharmacologists and neuro biologists.
It was a few years later, now at UCSD, that Eliezer
Masliah and I developed a technique for staining
synapses with anti-synaptophysin and for quantifying
their population density, first by image analysis [10].
The confocal microscope (I think ours was the first
in a neuropath lab) enabled even more precise, semiautomated synapse counts [11]. Here, finally, we found
the sort of strong clinico-pathologic correlations with
tests of cognition that were entirely convincing of a
rational causal mechanism of dementia [18].
During those first 15 or 20 years, I was most fortunate
to have in the lab for a year or more Kinuko Suzuki,
Nick Gonatas, Mike Shelanski, Henryk Wisniewski,
Dino Ghetti, Mauro Dal Canto, Dick Horoupian, Roy
Weller, Jan Leestma, Fernando Aleu, Cedric Raine,
John Prineas, Peter Davies, Khalid Iqbal, Jim Powers,
Jim Goldman, Sue Yen, Dennis Dickson and several
other excellent people. I hesitate to say that I trained
them, because what I really did was simply to provide
the environment and leave them pretty much alone to
develop. Their collaboration and their individual work
played a major role in all our thinking and in whatever
we accomplished.
Indeed, Ive been very lucky.
References
[1]
[2]
[3]
[4]
[5]
G. Blessed, B.E. Tomlinson and M. Roth, The association between quantitative measures of dementia and of senile changes
in the cerebral gray matter of elderly subjects, Brit. J. Psych.
114 (1968), 797811.
P. Davies and A. Maloney, Selective loss of central cholinergic
neurons in Alzheimers disease, Lancet 2 (1976), 1403.
P. Davies and R.D. Terry, Cortical somatostatin-like immunoreactivity in cases of Alzheimers disease and senile dementia of the Alzheimer type, Neurobiology of Aging 2 (1981),
914.
I.P. Everall, R. DeTeresa, R.D. Terry and E. Masliah, Comparison of two quantitative methods for the evaluation of neuronal number in the frontal cortex in Alzheimer disease, J.
Neuropath. & Expmt. Neurol. 56 (1997), 12021206.
T. Gomez-Isla, R. Hollister, H. West, S. Mui, J.H. Growden,
R.C. Petersen, J.E. Parisi and B.T. Hyman, Neuronal loss correlates with but exceeds neurofibrillary tangles in Alzheimers
disease, Ann. Neurol. 41 (1997), 1724.
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
119
Amyloid
123
Keywords: Memory, transgenic, mice, rats, Morris water maze, operant behavioral task, A oligomers
Address for correspondence: Karen H. Ashe, MD, PhD, Department of Neurology, Mayo Mail Code 295, 420 Delaware Street, SE,
Minneapolis, MN 55455, USA. Tel.: +1 612 626 0652; Fax: +1 612
626 2639; E-mail: hsiao005@umn.edu.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
124
K.H. Ashe / Molecular basis of memory loss in the Tg2576 mouse model of Alzheimers disease
K.H. Ashe / Molecular basis of memory loss in the Tg2576 mouse model of Alzheimers disease
[3]
[4]
[5]
4. Conclusion
Animal models are essential for elucidating the
pathophysiological and molecular mechanisms leading
to dementia in Alzheimers disease. Transgenic mouse
models expressing A, the principle molecular component of amyloid plaques in Alzheimers disease, have
helped to determine the molecular and cellular processes involved in producing cognitive deficits. Soluble
A oligomers are the leading candidate for A species
responsible for disrupting memory in APP transgenic
mice. Recently, we identified and isolated a soluble
A complex, called A*56, causing memory deficits
in the Tg2576 mouse model of Alzheimers disease.
If A*56 can be detected and successfully targeted
in humans with pre-clinical Alzheimers disease, then
this would be likely to have a similar impact in the
field of neurology as the early detection and treatment
of high blood pressure and high cholesterol have had
in the field of stroke and myocardial infarction prevention. Thus, the study of a mouse model of preclinical Alzheimers disease has been a valuable endeavour because it may lead to therapies that will
prevent the irreversible structural changes found in
Alzheimers disease. Although the Tg2576 model, created in my laboratory, is the most widely used model
of Alzheimers disease in the world, the majority of
investigators using the model have yet to recognize that
it more closely mimics individuals at high risk for developing Alzheimers disease than it resembles actual
Alzheimer patients. This knowledge, together with
125
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
126
[14]
K.H. Ashe / Molecular basis of memory loss in the Tg2576 mouse model of Alzheimers disease
M.A. Westerman, D. Cooper-Blacketer, A. Mariash, L. Kotilinek, T. Kawarabayashi, L.H. Younkin, G.A. Carlson, S.G.
Younkin and K.H. Ashe, The relationship between Abeta and
127
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
128
M. Tabaton and P. Gambetti / Soluble amyloid- in the brain: The scarlet pimpernel
M. Tabaton and P. Gambetti / Soluble amyloid- in the brain: The scarlet pimpernel
129
130
M. Tabaton and P. Gambetti / Soluble amyloid- in the brain: The scarlet pimpernel
timing of sA aggregation and accumulation was investigated by analyzing the brains of 22 cases of Downs
syndrome spanning both prenatal and postnatal periods. Soluble A 42 was detected in half of the fetal
brains, and in all postnatal cases, even in the young
cases (from 4 days up to 14 years old) where diffuse
amyloid plaques had not yet formed. In the same study,
we established that the pyroglutamate 342 peptide appeared later than the full-length form, and its appearance correlated with the formation of amyloid plaques.
Soluble A140 and Ax-40 were not detected in any
Downs syndrome case examined [24]. This study had
two major implications: 1) the overproduction of total
A due to APP over expression in Downs syndrome,
causes the seeding of only the A 42 species; and 2)
the initial seeding may begin more than a decade before
amyloid fibrils are formed.
M. Tabaton and P. Gambetti / Soluble amyloid- in the brain: The scarlet pimpernel
131
Acknowledgements
We are grateful to Ms. Allison Marsh for her contribution to the manuscript. Supported by NIH grants
AG14359, AG08012, CDC grant CCU 515004, the
Britton Fund.
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
132
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
M. Tabaton and P. Gambetti / Soluble amyloid- in the brain: The scarlet pimpernel
H. Mori, K. Takio, M. Ogawara and D.J. Selkoe, Mass spectrometry of purified amyloid beta protein in Alzheimers disease, J Biol Chem 267 (1992), 1708217086.
A. Piccini, C. Russo, A. Gliozzi, A. Relini, A. Vitali, R.
Borghi, L. Giliberto, A. Armirotti, C. DArrigo, A. Bachi,
A. Cattaneo, C. Canale, S. Torrassa, T.C. Saido, W. Markesbery, P. Gambetti and M. Tabaton, Beta amyloid is different
in normal aging and in Alzheimers disease, J Biol Chem 280
(2005), 3418634192.
M.B. Podlisny, B.L. Ostaszewski, S.L. Squazzo, E.H. Koo,
R.E. Rydell, D.B. Teplow and D.J. Selkoe, Aggregation of
secreted amyloid beta-protein into sodium dodecyl sulfatestable oligomers in cell culture, J Biol Chem 270 (1995),
95649570.
C. Russo, T.C. Saido, L.M. DeBusk, M. Tabaton, P. Gambetti
and J.K. Teller, Heterogeneity of water-soluble amyloid betapeptide in Alzheimers disease and Downs syndrome brains,
FEBS Lett 409 (1997), 411416.
C. Russo, G. Schettini, T.C. Saido, C. Hulette, C. Lippa, L.
Lannfelt, B. Ghetti, P. Gambetti, M. Tabaton and J.K. Teller,
Presenilin-1 mutations in Alzheimers disease, Nature 405
(2000), 531532.
N. Sergeant, S. Bombois, A. Ghestem, H. Drobecq, V. Kostanjevecki, C. Missiaen, A. Wattez, J.P. David, E. Vanmechelen, C. Sergheraert and A. Delacourte, Truncated beta-amyloid
peptide species in pre-clinical Alzheimers disease as new targets for the vaccination approach, J Neurochem 85 (2003),
15811591.
Y. Shinkai, M. Yoshimura, Y. Ito, A. Odaka, N. Suzuki, K.
Yanagisawa and Y. Ihara, Amyloid beta-proteins 140 and 1
42(43) in the soluble fraction of extra- and intracranial blood
vessels, Ann Neurol 38 (1995), 421428.
M. Shoji, T.E. Golde, J. Ghiso, T.T. Cheung, S. Estus, L.M.
Shaffer, X.D. Cai, D.M. McKay, R. Tintner, B. Frangione
et al., Production of the Alzheimer amyloid beta protein by
normal proteolytic processing, Science 258 (1992), 126129.
M. Tabaton, M.G. Nunzi, R. Xue, M. Usiak, L. Autilio-
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
133
Keywords: Transgenic mice, APP, amyloid-, Alzheimers disease, plaques, pathology, therapeutic, immunization
1. Introduction
One hundred years after Alzheimers disease (AD)
was first described in a demented female patient, transgenic mice have been engineered that express bits of
human genetic material and develop neuropathologies
that resemble her catastrophic disease. Today we take
transgenic mouse models of AD for granted; however,
a little over a decade ago they did not exist at all. These
valuable animals are now extensively used for both
mechanistic studies and the evaluation of previously
untestable potential therapeutic interventions. The purpose of this commentary is to review a few illustra-
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
134
135
136
Mouse
NSEAPP
PDAPP
Tg2576
APP23
PSAPP
Transgene
APP 751
APPIndiana
APPSwe
APPSwe
APPSwe PS1
M146L
APPDutch
APP E693Q
TGF1/APP TGFb 1APPSwe
APIndiana
TAPP
Tau P301L
APPSwe
3XTG
PS1 M146V
APPSwe
Tau P301L
APP-PS1
APPSwe ,
APPLondon
PS1M146L
Strain
Promoter
JU
B6/D2/SW
B6/SJL
B6/D2
B6/SW/D2
NSE
PDGF-b
PrP
Thy1
PDGF-b
PrP
B6
Thy1
Balbc/SJL/ GFAP
B6/D2
PDGF-b
AP
+
+++
++
+++
+ + ++
INeur.
A
DN
+
+
++
+
++
+++
+
+
B6/D2/SW PrP
++
B6
Thy1.2
++
B6/CBA
Thy-1
HMG
+++
Phenotype
VA
Gli
+
++
+++
++
Syn NFT
Loss
+
+ + + ++
++
+++
+++
NL
COG Ref
++
++
++
++
++
[41]
[112]
+ + ++ + + +
+++
++
++
[86]
[32]
[44]
[94]
[43]
++
++
+ + ++ + + +
+++
++
+ + ++ + + +
+++
NA
[64]
[82]
+++
[91]
Fig. 1. Examples of A plaque and related pathologies typical of transgenic mouse models of AD. A plaques reacted with a human-specific
A antibody (3D6- recognizing the first 5 amino acids of A), in sections of the neocortex from an (A) AD brain and (B) the PDAPP transgenic
mouse. (C) Plaque associated dystrophic neurites, labeled with an antibody against human APP (8E5). (D) Confocal image of a compacted
amyloid plaque (red) associated with dystrophic neurites (green) in a PDAPP mouse.
the water maze, the radial arm water maze, the circular holeboard maze, contextual fear conditioning, operant learning, passive avoidance, and the T- and Ymazes [11,13,17,20,22,24,43,46,53,55,85,106]. In addition, hAPP mice display impaired performance in a
number of non-spatial memory tasks, including auditory startle, eyeblink conditioning, object recognition,
and paired pulse inhibition [11,24,58,72,104]. While
some aspects of all of these impairments are present before the appearance of A deposits in singly-transgenic
hAPP mice, other deficits in working memory retention and acquisition in the water maze, the holeboard maze, and auditory startle tasks progressively
worsen with age and parallel the appearance of cerebral plaques [11,13,53,106]. Transgenic hAPP mice
also have a wide range of non-memory sensorimotor perturbations, including hyperactivity, reductions in
3. Genetic manipulations
3.1. A plaque-related pathologies
The quest to reveal causal factors of A deposition
and modulate plaque formation began with the first confirmation of bona fide A plaques in hAPP mice, and
continues to this day. These hallmarks of AD plaque
pathology, despite controversy over their direct role in
toxicity, still represent the principle gauge by which
disease-relevant mechanisms and potential therapeutics
are measured. Factors that enhance or deter the production, clearance or aggregation of plaques have all
been examined in transgenic mouse models of AD.
Shortly after plaque pathology was produced in the
PDAPP and Tg2576 mice, transgenic expression of
disease-linked mutant PS1 was found to subtly elevate A42 in the absence of extracellular plaque formation [25]. This effect was also further established
by other investigators who produced several mutant
PS1 lines that were cross-bred with wildtype hAPP
transgenic mice [18]. Remarkably, when mutant PS1
and Tg2576 mice were cross-bred, the resulting bigenic mice had greatly enhanced and accelerated plaque
deposition compared to the original line of TG2576
mice [43]. Plaque acceleration was also demonstrated
in another study of bigenic mice expressing another
PS1 mutation (A246E), together with the APPSwe
mutation, while it did not occur in bigenic mice expressing wildtype PS1 [8]. Intriguingly, these early ob-
137
138
loid load was also associated with a reduction in compact plaque-associated neuritic dystrophy as visualized
with a hyperphosphorylated tau antibody. Complicating the picture and reminiscent of the studies mentioned
above, the decrease in parenchymal load was associated
with an increased CAA burden and vascular degeneration [113]. This inverse correlation between plaque
load and CAA was also observed in sections from AD
brain, and a positive correlation was found in the human
cases between TGF-1 mRNA levels and CAA severity [112]. In an earlier study, it was shown that transgenic TGF-1 expression was associated with a pronounced alteration of the extracellular matrix (ECM),
including increased deposition of laminin, fibronectin
and heparin sulphate proteoglycan [111]. The amount
of A42 did not appear to be altered in young bigenic
mice. Instead, the expression of TGF-1 in perivascular astroglial endfeet resulted in CAA formation in
older animals, possibly due to the increase of perlecan
and fibronectin in the vascular ECM beginning at a
young age.
Since C3, a central component of the complementmediated inflammatory cascade, was elevated in the
brains of TGF-1/APP bigenic mice, Wyss-Coray
and his colleagues created another line of bigenic mice
to determine the role of C3 in plaque deposition [114].
Complement-related receptor protein (Crry), an inhibitor of C3 convertases, inhibits the pro-inflammatory
capability of C3. When soluble Crry was expressed in
hAPP mice, the resulting bigenic mice actually had
a 23 fold increase in plaque load. An accumulation
of electron dense neurons, loss of the neuronal marker
Neu N and a decrease in MAP-2 positive dendrites in
the bigenic mice suggested that degenerative cascades
might also have been potentiated by C3 inhibition.
New insights regarding the regulation of amyloid
processing continue to emerge using bigenic APP
mice. An example comes from a recent study in which
transgenic mice overexpressing the neuronal adaptor
protein X11b were crossed with the Tg2576 transgenic
mice [63]. X11b is a member of a family of adaptor
proteins that can bind to the carboxyl terminus of APP.
Plaque formation was markedly reduced in these older
bigenic mice. Similar results were reported by this
group after overexpression of a related protein, X11a,
in TG2576 mice. Although the precise mechanisms
underlying these effects remain unknown, it illustrates
the potential of alternative A-modulating approaches.
3.2. Neurodegenerative pathologies
As indicated above, APP transgenic mice have a
number of deficits that indicate neuronal function is
139
traneuronal A, particularly A42, has also been implicated as an early event in Downs syndrome pathology [40,77] and AD [39]. Another more recent study
demonstrated that behavioral deficits were correlated
with intraneuronal A in the 3xTg transgenic mice [6]:
Also see NFT Pathology below and Table 1). It appears that the production of substantial neuronal loss in
rodents requires quite aggressive tactics-the creation of
these triple and quadruple mutated animals are certainly different creatures from the first generation of
hAPP mice. Despite these accomplishments, no significant NFT pathology developed in mice expressing
hAPP and PS1 mutations. For years, it was not clear
that rodents could ever develop tangle pathology, under
any condition.
3.4. NFT pathology
This quandary has since been addressed by the creation of bigenic mice that express mutated forms of
human APP and tau proteins. Transgenic tau mice
(called JNPL3 mice) were first created that expressed
a mutated form of tau (P301L), linked to human cases
of frontotemporal dementia and Parkinsonism linked to
chromosome 17 (FTDP-17) in which NFTs are a predominant feature [65]. These mice developed the elusive NFT pathology, being appropriately labeled with
the classic Congo red, thioflavin and silver-based stains.
Pick body-type and pre-tangle lesions (tau immunoreactive only) were also found. The NFTs were predominantly located in subcortical regions, while the pretangle pathology was noted in the cortex and hippocampus. Severe motor deficits were associated with axonal
degeneration and loss of motor neurons in the spinal
cord. Insoluble tau from the brain and spinal cord of
the mice co-migrated with insoluble tau from AD and
FTDP-17 brains. Ultrastructural analysis revealed intraneuronal accumulations of 1520 nm straight and
wavy filaments composed of tau [67]. Although the
characteristic periodic twists typical of NFTs found in
AD [54] were not seen in the mice, the morphology was
similar to a number of other human tauopathies. In order to examine the effects of A production on this NFT
pathology, the P310L mice were crossed to Tg2576
mice (the bigenic progeny called TAPP mice) [64]. Although the extent of A pathology was not affected
in the TAPP mice, a striking alteration in the distribution of the NFTs occurred. In older female mice,
they were found in the hippocampus, subiculum and
cortex regions that rarely or never formed NFTs in the
JNPL3 animals. The increased NFT pathology devel-
140
4. Therapeutic interventions
Aside from having utility in characterizing the progression and interdependencies of various AD-like
pathologies, the overriding goal of these animal models
of the disease is to employ them in identifying therapies
for treating, and ideally preventing or reversing, the disease in man. Before transgenic models became available, trying to identify potential Alzheimers disease
modifying therapies was an extremely difficult proposition. One approach has been to conduct epidemiological searches of various patient databases to identify
therapies that may impact the course or induction of
AD. The results of these efforts remain in many cases
controversial or not borne out in actual clinical trials and
include investigations of anti-inflammatory drugs, vitamins, hormone replacement therapy, cholesterol lowering agents, and essentially all medicines commonly
dosed into large populations of elderly subjects [115].
A number of trials to monitor AD progression with
potential protective or preventative therapies have also
been initiated based on various hypotheses, typically
using medicines approved for other indications. Such
studies serve to illustrate the huge cost, lengthy trial
duration, and relatively large cohorts needed to test
a given treatment. For example, a study designed to
test whether the COX-2 inhibitor rofecoxib could delay the progression to Alzheimers disease in mild cog-
141
Fig. 2. Synaptophysin immunoreactivity in (A) 18 month old PDAPP mice is decreased compared to (D) non-transgenic mice. Synaptophysin
immunoreactivity is preserved in PDAPP mice after (E) active (administration of adjuvanted A 142) and (F) passive (administration of anti-A
antibodies) treatment paradigms, compared to (B, C) their respective non-treated control groups. Bar = 50 m.
Fig. 3. A confocal image of phagocytosis of deposited A (green) by MHC II-positive microglial cells (red) in a PDAPP mouse brain, after 6
months of immunization with adjuvanted A 142.
142
ies has been the use of anti-A immunotherapies (Reviewed in [34] and [75]). In 1999, our group described
the impressive AD-neuropathology preventative effects
of immunizing the PDAPP transgenic mouse with
A [90]. Subsequent studies in our laboratories and
many others demonstrated that anti-A antibodies were
capable of reducing amyloid plaques and associated
neuropathologies. Also encouraging is the preservation of cortical synaptophysin levels by immunotherapy
(Fig. 2), an important correlate of cognitive function in
humans.
Further strengthening the case for functional improvement following immunotherapy, a number of
studies using transgenic hAPP and PS1 mice have
been published, describing amelioration of established
behavioral deficits (Table 2). Long-term A immunization of Tg2576 and APP + PS1 mice resulted in improvements in both the radial arm and typical versions
of the water maze [51,76]. Passive immunization studies in which A antibodies were given for short-term
treatment schedules also resulted in positive cognitive
changes in transgenic mice, as PDAPP mice given the
monoclonal 266 antibody had improved object recognition performances, while Tg2576 mice given the Nterminus amyloid antibody BAM-10 showed increased
spatial memory retention in the water maze relative to
controls [23,56].
Precise details of the possible immunotherapeutic
mechanisms of action are still an area of spirited scientific discussion. The overall consensus is that antibodies are capable of having several effects including
plaque clearance (through both monocyte-mediated [4]
(Fig. 3) and direct effects [3] and capture/clearance of
soluble A species that are neuroactive/toxic [60]. Recently, antibody-mediated clearance of even intracellular amyloid has been reported [6,81].
Immunization with A142 (referred to as AN-1792
in clinical trials) was tested in human AD cases with
noteworthy effects. Dosing in the trials was suspended
after several cases (eventually 6% of the treated subjects) developed meningoencephalitis [83]. This side
effect highlights a limitation of the animal models in
that they do not necessarily perfectly predict clinical
outcomes, which may be due to limitations in the models pathology as well as the more genetically varied
human population. Interestingly, several cases from
these studies have gone to autopsy due to causes other
than the immunotherapy, and showed strikingly similar reductions in AD neuropathologies as predicted by
the mouse model [28,69,80]. Finally, certain memory
related tests, as well as the CSF biomarker tau, seemed
Table 2
Behavioral Phenotypes of Transgenic Mouse Models and Cognitive Changes Following Amyloid Immunotherapy
Tg2576
APP23
TgCRND8
35, 2026
3
6, 910
3, 6
11
6, 10
Hyperactivity
Perturbed sleep/wake patterns
3, 6, 9
35, 2026
3, 9, 19
11.5, 15.5
Hyperactivity
Open Field
17
10, 16
3, 6, 18, 25
Hyperactivity
Open Field
Rotorod
1.52, 3, 6
3, 6
3, 6
3, 7, 9
10, 16
10, 1618
1618
References
[23]
[76]
spatial acquistion
[56]
2.75
[51]
TgCRND mice tested at 11, 15, 19, 23w improvements in water maze
spatial reference memory
A142, 1x mo from 7.5mo,
Treated APP + PS1 mice displayed
25
45, 11.5, 14.516.5, 1517, 15.5 Tg2576 mice tested at 11.5, 15.5 mo
33.5, 57, 6, 9, 1517
[76]
Boldface type indicates specific behavioral tasks in which hAPP performance progressively worsens with age, and their time of onset in months.
143
144
Percentage Reduction in
Plaque Burden
@ low dose 50%;
6 mo Tg2576
NS at high dose Reduced levels of oxidized proteins and
IL-1B
iABeta5p
-sheet disrupt- 1 mg, 3x/week 8 wk APPV717I X 9 months (3 months 45% in cortex; 29%
ing peptide
I.V.
PS-1A246E
after plaques begin in hippocampus
to appear).
Lithium
GSK3 Kinase 2.4 g/kg in chow
7 mo PDAPP
1 month old, before 75%
inhibition
(homozygous) plaques present.
4.5 months, when 90%
CP-113,818 ACAT inhibitor 7.2
mg/kg/day 2 mo A PPSw
+Ldn
plaques are just
Subcu-taneous
forming
implant
Clioquinol Copper-Zinc
30 mg/kg/dayoral 9 wks Tg2576
21 months of age, 49%
chelation
well after plaque
initiation
375 ppm in chow 5 mo SwAPP X PS- 7 months, plaque 45%
NCX-2216 NO-releasing
1M146L
formation evident
NSAID;
at that age
microglial
activation
Dose and Route
Test Article Proposed
Mechanism of
Action
Curcumim Amyloid bind- 160 and 5000
ing anti-oxidant ppm in chow
in curry powder
Length AD Model
Age/Amyloid
Burden at Therapy
Initiation
10 months of age
when few plaques
present.
Other Reported
Efficacy
Ref
[66]
[84]
Reduced
neuronal death in
subiculum
[95]
Spatial learning [47]
improved
[15]
References were selected from peer-reviewed reports in which therapeutic agents showed efficacy in reducing, at a minimum, amyloid plaque
load after chronic (>2 months) treatment. Note that despite very different reported mechanisms of action, all have reported efficacy. The wide
variance in animal models, duration and age of treatment, and methods of quantitation preclude direct comparisons between studies.
6. Summary
While truly effective therapies for AD are still works
in progress, the past decade has seen a revolution in
potential treatments that may eventually spell the end
to one of the most increasingly common and dreaded
diseases. The advent of transgenic animal models has
exponentially enabled rapid exploration of mechanisms
of disease and potential therapies. Testing of hypotheses that could never have been approved or afforded
for study in man are now routine because of these animal models. The existence of these mice could not
have been imagined 100 years ago, when AD was first
described. Hopefully, before the next century is over,
living with AD will itself be unimaginable.
References
[1]
[2]
[3]
[4]
[5]
Acknowledgement
[6]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
145
146
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
and B. Sommer, Progressive age-related impairment of cognitive behavior in APP23 transgenic mice, Neurobiology of
Aging 24 (2003), 365378.
M. Kidd, Paired helical filaments in electron microscopy of
Alzheimers disease, Nature 197 (1963), 192193.
D.L. King, G.W. Arendash, F. Crawford, T. Sterk, J. Menendez and M.J. Mullan, Progressive and gender-dependent cognitive impairment in the APP(SW) transgenic mouse model
for Alzheimers disease, Behavioural Brain Research 103
(1999), 145162.
L.A. Kotilinek, B. Bacskai, M. Westerman, T.
Kawarabayashi, L. Younkin, B.T. Hyman, S. Younkin and
K.H. Ashe, Reversible memory loss in a mouse transgenic
model of Alzheimers disease, Journal of Neuroscience 22
(2002), 63316335.
L.S. Kulnane and B.T. Lamb, Neuropathological characterization of mutant amyloid precursor protein yeast artificial
chromosome transgenic mice, Neurobiology of Disease 8
(2001), 982992.
R. Lalonde, T.L. Lewis, C. Strazielle, H. Kim and K. Fukuchi,
Transgenic mice expressing the betaAPP695SWE mutation:
effects on exploratory activity, anxiety, and motor coordination, Brain Research 977 (2003), 3845.
B.T. Lamb, K.A. Bardel, L.S. Kulnane, J.J. Anderson, G.
Holtz, S.L. Wagner, S.S. Sisodia and E.J. Hoeger, Amyloid
production and deposition in mutant amyloid precursor protein and presenilin-1 yeast artificial chromosome transgenic
mice, Nature Neuroscience 2 (1999), 695697.
M.P. Lambert, K.L. Viola, B.A. Chromy, L. Chang, T.E.
Morgan, J. Yu, D.L. Venton, G.A. Krafft, C.E. Finch and W.L.
Klein, Vaccination with soluble Abeta oligomers generates
toxicity-neutralizing antibodies, Journal of Neurochemistry
79 (2001), 595605.
T.A. Lanz, D.B. Carter and K.M. Merchant, Dendritic spine
loss in the hippocampus of young PDAPP and Tg2576 mice
and its prevention by the ApoE2 genotype, Neurobiol Dis 13
(2003), 246253.
J. Larson, G. Lynch, D. Games and P. Seubert, Alterations
in synaptic transmission and long-term potentiation in hippocampal slices from young and aged PDAPP mice, Brain
Research 840 (1999), 2335.
J.H. Lee, K.F. Lau, M.S. Perkinton, C.L. Standen, B. Rogelj,
A. Falinska, D.M. McLoughlin and C.C. Miller, The neuronal
adaptor protein X11beta reduces amyloid beta-protein levels
and amyloid plaque formation in the brains of transgenic
mice, Journal of Biological Chemistry 279 (2004), 49099
49104.
J. Lewis, D.W. Dickson, W.L. Lin, L. Chisholm, A. Corral, G.
Jones, S.H. Yen, N. Sahara, L. Skipper, D. Yager, C. Eckman,
J. Hardy, M. Hutton and E. McGowan, Enhanced neurofibrillary degeneration in transgenic mice expressing mutant tau
and APP.[see comment], Science 293 (2001), 14871491.
J. Lewis, E. McGowan, J. Rockwood, H. Melrose, P.
Nacharaju, M. Van Slegtenhorst, K. Gwinn-Hardy, M. Paul
Murphy, M. Baker, X. Yu, K. Duff, J. Hardy, A. Corral,
W.L. Lin, S.H. Yen, D.W. Dickson, P. Davies and M. Hutton, Neurofibrillary tangles, amyotrophy and progressive motor disturbance in mice expressing mutant (P301L) tau protein.[erratum appears in Nat Genet 2000 Sep;26(1):127], Nature Genetics 25 (2000), 402405.
G.P. Lim, T. Chu, F. Yang, W. Beech, S.A. Frautschy and
G.M. Cole, The curry spice curcumin reduces oxidative
damage and amyloid pathology in an Alzheimer transgenic
mouse, Journal of Neuroscience 21 (2001), 83708377.
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[74]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
147
W.L. Lin, J. Lewis, S.H. Yen, M. Hutton and D.W. Dickson, Ultrastructural neuronal pathology in transgenic mice
expressing mutant (P301L) human tau, Journal of Neurocytology 32 (2003), 10911105.
H.J. Luth, J. Apelt, A.O. Ihunwo, T. Arendt and R. Schliebs,
Degeneration of beta-amyloid-associated cholinergic structures in transgenic APP SW mice, Brain Research 977
(2003), 1622.
E. Masliah, L. Hansen, A. Adame, L. Crews, F. Bard, C.
Lee, P. Seubert, D. Games, L. Kirby and D. Schenk, Abeta
vaccination effects on plaque pathology in the absence of encephalitis in Alzheimer disease, Neurology 64 (2005), 129
131.
E. Masliah, A. Sisk, M. Mallory and D. Games, Neurofibrillary pathology in transgenic mice overexpressing V717F
beta-amyloid precursor protein, Journal of Neuropathology
& Experimental Neurology 60 (2001), 357368.
E. Masliah, R.D. Terry, R.M. DeTeresa and L.A. Hansen,
Immunohistochemical quantification of the synapse-related
protein synaptophysin in Alzheimer disease, Neurosci Lett
103 (1989), 234239.
M.F. McCool, G.B. Varty, R.A. Del Vecchio, T.M. Kazdoba,
E.M. Parker, J.C. Hunter and L.A. Hyde, Increased auditory
startle response and reduced prepulse inhibition of startle in
transgenic mice expressing a double mutant form of amyloid
precursor protein, Brain Research 994 (2003), 99106.
E.G. McGeer and P.L. McGeer, Innate immunity in
Alzheimers disease: a model for local inflammatory reactions, Mol Interv 1 (2001), 2229.
M.J. McNamara, T. Gomez-Isla and B.T. Hyman,
Apolipoprotein E genotype and deposits of Abeta40 and
Abeta42 in Alzheimer disease, Archives of Neurology 55
(1998), 10011004.
D. Morgan, Antibody therapy for Alzheimers disease, Expert Review of Vaccines 2 (2003), 5359.
D. Morgan, D.M. Diamond, P.E. Gottschall, K.E. Ugen, C.
Dickey, J. Hardy, K. Duff, P. Jantzen, G. DiCarlo, D. Wilcock,
K. Connor, J. Hatcher, C. Hope, M. Gordon and G.W. Arendash, A beta peptide vaccination prevents memory loss in an
animal model of Alzheimers disease.[see comment][erratum
appears in Nature 2001 Aug 9;412(6847):660], Nature 408
(2000), 982985.
C. Mori, E.T. Spooner, K.E. Wisniewsk, T.M. Wisniewski,
H. Yamaguch, T.C. Saido, D.R. Tolan, D.J. Selkoe and C.A.
Lemere, Intraneuronal Abeta42 accumulation in Down syndrome brain, Amyloid 9 (2002), 88102.
L. Mucke, E. Masliah, G.Q. Yu, M. Mallory, E.M. Rockenstein, G. Tatsuno, K. Hu, D. Kholodenko, K. JohnsonWood and L. McConlogue, High-level neuronal expression
of abeta 142 in wild-type human amyloid protein precursor
transgenic mice: synaptotoxicity without plaque formation,
Journal of Neuroscience 20 (2000), 40504058.
J. Murrell, M. Farlow, B. Ghetti and M.D. Benson, A mutation in the amyloid precursor protein associated with hereditary Alzheimers disease, Science 254 (1991), 9799.
J.A. Nicoll, D. Wilkinson, C. Holmes, P. Steart, H. Markham
and R.O. Weller, Neuropathology of human Alzheimer disease after immunization with amyloid-beta peptide: a case
report.[see comment], Nature Medicine 9 (2003), 448452.
S. Oddo, L. Billings, J.P. Kesslak, D.H. Cribbs and F.M.
LaFerla, Abeta immunotherapy leads to clearance of early,
but not late, hyperphosphorylated tau aggregates via the proteasome.[see comment], Neuron 43 (2004), 321332.
148
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]
[102]
[103]
[104]
[105]
[106]
[107]
[108]
[109]
[110]
[111]
[112]
[113]
[114]
[115]
149
lective vulnerability of dentate granule cells prior to amyloid deposition in PDAPP mice: digital morphometric analyses, Proceedings of the National Academy of Sciences of the
United States of America 101 (2004), 71417146.
T. Wyss-Coray, L. Feng, E. Masliah, M.D. Ruppe, H.S. Lee,
S.M. Toggas, E.M. Rockenstein and L. Mucke, Increased
central nervous system production of extracellular matrix
components and development of hydrocephalus in transgenic mice overexpressing transforming growth factor-beta
1, American Journal of Pathology 147 (1995), 5367.
T. Wyss-Coray, C. Lin, F. Yan, G.Q. Yu, M. Rohde, L. McConlogue, E. Masliah and L. Mucke, TGF-beta1 promotes
microglial amyloid-beta clearance and reduces plaque burden in transgenic mice.[see comment], Nature Medicine 7
(2001), 612618.
T. Wyss-Coray, E. Masliah, M. Mallory, L. McConlogue, K.
Johnson-Wood, C. Lin and L. Mucke, Amyloidogenic role of
cytokine TGF-beta1 in transgenic mice and in Alzheimers
disease, Nature 389 (1997), 603606.
T. Wyss-Coray, F. Yan, A.H. Lin, J.D. Lambris, J.J. Alexander, R.J. Quigg and E. Masliah, Prominent neurodegeneration and increased plaque formation in complement-inhibited
Alzheimers mice, Proceedings of the National Academy of
Sciences of the United States of America 99 (2002), 10837
10842.
P.P.B.J.C.S. Zandi, Do NSAIDs prevent Alzheimers disease?
And, if so, why? The epidemiological evidence, Neurobiology of Aging 22 (2001), 811817.
151
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
152
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
References
[1]
[13]
[14]
[15]
[16]
153
155
Department of Pathology, The University of Melbourne, and the Mental Health Research Institute of Victoria,
Australia
b
Centre for Molecular Biology, The University of Heidelberg, Germany
Abstract. Many participants played a role in discovering the composition and
sequence of the A amyloid of Alzheimers disease. This sequence enabled the
cloning of the amyloid precursor protein (APP), which elucidated its proteolytic
origin from the membrane of neurons. The proteolytic enzymes which process
APP and the A fragment itself are now the prime validated drug targets for
therapeutic intervention.
Approaching the centennial year of Alzheimers presentation of a distinct form of neurodegeneration [2],
we can look back over the past two decades during
which an extraordinary research effort has been underway elucidating the role of A amyloid in the causation
of Alzheimers disease (AD). Our contributions in the
1980s [20,2733,44] to the purification and N-terminal
sequencing of the amyloid plaque cores (APC) of AD
and the discovery of its biogenesis from a neuronal
precursor (the amyloid protein precursor APP) by
proteolytic cleavages (the - and -secretases) needs
to be seen on the background of many years of prior
research activity from a diverse range of individuals
and groups. In this article, we summarize the interconnecting pathways which led to these discoveries and
Corresponding author: Colin L. Masters, Department of Pathology, The University of Melbourne, Victoria 3010, Australia. Tel.:
+61 3 8344 5868; E-mail: c.masters@unimelb.edu.au.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
156
C.L. Masters and K. Beyreuther / Pathways to the discovery of the A amyloid of Alzheimers disease
C.L. Masters and K. Beyreuther / Pathways to the discovery of the A amyloid of Alzheimers disease
157
158
C.L. Masters and K. Beyreuther / Pathways to the discovery of the A amyloid of Alzheimers disease
the most effective solvent (a tip derived from the previous generation of Australian wool protein chemists).
Beyreuther readily agreed to collaborate, and Masters
sent purified AD-APC to him and Gerd Multhaup for
sequencing at the Institute for Genetics, Cologne. Our
method for the APC purification now consisted of a
pepsin digestion, Triton X100/high salt extraction followed by separation on a discontinuous sucrose gradient. Beyreuther and Multhaup were able to solubilize
the AD-APC in formic acid and obtain a very ragged
N-terminal sequence as far as residue 28 (four more
than Glenner!). On SDS gels, dimers and higher order
aggregates were readily observed of the 4 kD monomer,
which at the time, in conformance with the International Nomenclature rules, we referred to as A 4 (and
the oligomers as A8 , A16 , A64 , etc., the A standing
for either Amyloid or Alzheimer). We noted the pHdependence of this aggregation process as being typical
of protonation of histidines.
Glenners next paper [13] appeared while we were
making rapid progress with our own analyses. He now
referred to the 1 /2 peptide as the protein, corrected his sequencing error at residue 11, and predicted
that since the amyloid N-terminal sequence from a vascular preparation from a case of Downs syndrome was
the same as from AD, that there would be a gene defect
on chromosome 21 responsible for AD.
By late 1984, we had assembled enough data from
our APC studies to draft a manuscript which was submitted to PNAS, and accepted in January 1985 [32].
In the acknowledgements, we thanked Steve Bobin,
Michael Landon and George Glenner for helpful discussions. This was certainly true for Bobin and Landon, with whom we had developed cordial relationships. Glenner, however, maintained a very standoffish attitude, and even had the presumption to request further supplies of our purified APC (see Fig. 1
1 mg would be fine!). Our PNAS paper [32] was
published in June 1985. Subsequent discussions with
Glenner showed that he believed that we could never
have obtained our results without reference to his 124
sequence, and that he was extremely annoyed at our
incursion into his domain. For many years thereafter,
he maintained that the basic amyloid subunit was 28
residues in length. Initially, we ourselves were uncertain whether the N-terminal raggedness was an artefact
of the preparative method, or caused by non-specific
degradation of material remaining in situ for extended
periods. Further studies from our laboratories [16,30]
and others [14] suggested that the latter interpretation
was more likely. The strong amyloidogenic propensity
of synthetic A4 was easily demonstrable [22,30].
C.L. Masters and K. Beyreuther / Pathways to the discovery of the A amyloid of Alzheimers disease
159
Fig. 1. Image of a reprint sent to CLM from George Glenner, at some time in late 1984, with the inscription 1 mg would be fine, referring to the
collaboration in which Masters had previously sent him samples of purified AD-APC for X-ray diffraction studies, Glenner was now requesting
further supplies. No results ever came from this collaboration.
160
C.L. Masters and K. Beyreuther / Pathways to the discovery of the A amyloid of Alzheimers disease
tween the APC of AD and the chemical profile of inhibiting infectivity of scrapie [32]. At that time (late
1984), the PrP protein had been identified [4], the prion
rods/filaments were known to bind Congo Red [39]
and the N-terminal sequence of PrP had been published [38]. By the time we had assembled the arguments for the neuronal origin paper [30], the full sequence of the PrP cDNA was known [37] and observed
to be expressed in the brain (equally in control and in
infected animals). Within a short period of time, the
PrP-composition of the CJD/GSS/scrapie-amyloid was
confirmed by immunological techniques [24] and the
neuronal origin of PrP demonstrated [25]. Just as we
had observed with AD-APC immunoreactivity for A
epitopes, the antigenic enhancement of PrP amyloid
with formic acid pre-treatment [27] suggested a common conformation underlay both types of extracellular
deposits. Thus, by 1987, we could see that the purified kuru plaques and GSS amyloid that had led us into
the AD story were also repositories of the secrets of
the inherent infectivity of the PrP protein. It has now
taken Prusiners team and collaborators almost another
20 years to devise the experimental conditions required
for the proof of the prion theory. There still remains a
major gap in the prion field in that the molecular mechanisms underlying the toxicity (neuronal vacuolation?)
leading to neurodegeneration remain unexplained. Our
observations in 1985/1986 that the AD brain is under
severe oxidative stress [27] were the first to suggest that
the accumulation of A in the AD brain might cause
damage through some redox-active chemistry. This is
currently one of our major strategies directed at therapeutic interventions in AD. It remains probable that
similar processes might underlie the damage induced
by an abnormal conformer of the PrP protein (and indeed the -synuclein of Parkinsons disease, the SOD1 in amyotrophic lateral sclerosis, the polyglutamine
expansions of Huntingtons disease, the tauopathy of
Picks disease, and complement factor H in age related
macular degeneration).
Once we had determined the N-terminal sequence of
the AD amyloid, it was clear that the major challenge
ahead was to use this information to derive a cDNA
clone to uncover the precursor protein. This came to
fruition in the second half of 1986 [20,44].
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
A. Alzheimer, Uber
eine eigenartige Erkrankung der Hirnrinde, Allgem. Zeit. Psychiat. und Psych. Gerich. Med. 64
(1907), 146148.
M. Bielschowsky, Histopathology of nerve cells, in: Cytology
and Cellular Pathology of the Nervous System, (Vol. 1), W.
Penfield, ed., Hafner Publishing Co., New York (1965 facsimile of 1932 edition), pp. 145188.
D.C. Bolton, M.P. McKinley and S.B. Prusiner, Identification
of a protein that purifies with the scrapie prion, Science 218
(1982), 13091311.
J.P. Brion, P. van den Bosch de Aguilar and J. FlamentDurand, Senile dementia of the Alzheimer type: morphological and immunocytochemical studies, in: Senile Dementia
of the Alzheimer Type: Early Diagnosis, Neuropathology and
Animal Models, J. Traber and W.H. Gispen, eds, SpringerVerlag, Berlin, 1985, pp. 164174.
J.M. Candy, J. Klinowski, R.H. Perry, E.K. Perry, A. Fairbairn,
A.E. Oakley, T.A. Carpenter. J.R. Atack, G. Blessed and J.A.
Edwardson, Aluminosilicates and senile plaque formation in
Alzheimers disease, Lancet 1 (1986), 354357.
O. Fischer, Miliare Nekrosen mit drusigen Wucherungen der
Neurofibrillen, eine regelmassige Veranderung der Hirnrinde
bei seniler Demenz, Monat. Psychiatr. Neurol. 22 (1907), 361
372.
R.L. Friede, Enzyme histochemical studies of senile plaques,
J. Neuropathol. Exp. Neurol. 24 (1965), 477491.
J. Ghiso, O. Jensson and B. Frangione, Amyloid fibrils in
hereditary cerebral hemorrhage with amyloidosis of Icelandic
type is a variant of -trace basic protein (cystatin C), Proc.
Natl. Acad. Sci. USA 83 (1986), 29742978.
G.G. Glenner, Amyloid deposits and amyloidosis. The betafibrilloses, N. Engl. J. Med. 302 (1980), 12831292 and 1333
1343.
G.G. Glenner, W. Terry, M. Harada, C. Isersky and D. Page,
Amyloid fibril proteins: proof of homology with immunoglobulin light chains by sequence analyses, Science 172 (1971),
11501151.
G.G. Glenner and C.W. Wong, Alzheimers disease: initial
report of the purification and characterization of a novel cerebrovascular amyloid protein, Biochem. Biophys. Res. Commun. 120 (1984), 885890.
G.G. Glenner and C.W. Wong, Alzheimers disease and
Downs syndrome: sharing of a unique cerebrovascular amyloid fibril protein, Biochem. Biophys. Res. Commun. 122
(1984), 11311135.
P.D. Gorevic, F. Goni, B. Pons-Estel, F. Alvarez, N.S. Peress
and B. Frangione, Isolation and partial characterization of
neurofibrillary tangles and amyloid plaque core in Alzheimers
disease: immunohistological studies, J. Neuropathol. Exp.
Neurol. 45 (1986), 647664.
I. Grundke-Iqbal, A.B. Johnson, H.M. Wisniewski, R.D. Terry
and K. Iqbal, Evidence that Alzheimer neurofibrillary tangles
originate from neurotubules, Lancet 1 (1979), 578580.
D.C. Guiroy, M. Miyazaki, G. Multhaup, P. Fischer, R.M. Garruto, K. Beyreuther, C.L. Masters, G. Simms, C.J. Gibbs Jr.
and D.C. Gajdusek, Amyloid of neurofibrillary tangles of Guamanian parkinsonism-dementia and Alzheimer disease share
identical amino acid sequence, Proc. Natl. Acad. Sci. USA 84
(1987), 20732077.
Y. Ihara, C. Abraham and D.J. Selkoe, Antibodies to paired helical filaments in Alzheimers disease do not recognize normal
brain proteins, Nature 304 (1983), 727730.
Y. Ihara, N. Nukina, R. Miura and M. Ogawara, Phosphorylated tau protein is integrated into paired helical filaments in
C.L. Masters and K. Beyreuther / Pathways to the discovery of the A amyloid of Alzheimers disease
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
161
163
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
164
D.J. Selkoe / Amyloid -peptide is produced by cultured cells during normal metabolism: A reprise
D.J. Selkoe / Amyloid -peptide is produced by cultured cells during normal metabolism: A reprise
165
Fig. 1. Peptides of Mr , 4 kDa and 3 kDa are specifically immunoprecipitated from culture medium by various antibodies to A. Comparison of the amounts of 4 kDa and 3 kDa peptides produced by untransfected 293 cells (lane 2) and by 293 cells stably transfected with
-APP695 (lane 4). R1280 precipitated substantially more 4 kDa
and 3 kDa peptides from the transfected cells. Preimmune serum was
negative (lanes 1 and 3). A 218 kDa protein was nonspecifically precipitated in variable amounts by both preimmune and immune sera.
From Nature 359, 322325, 1992. Copyright permission granted by
Nature.
166
D.J. Selkoe / Amyloid -peptide is produced by cultured cells during normal metabolism: A reprise
Conclusion
On a personal level, it was enormously exciting and
satisfying to be able to participate in the studies reviewed herein. I am deeply indebted to Christian Haass
and Michael Schlossmacher and to our innovative and
committed collaborators mentioned earlier. Science in
the modern era has increasingly flourished on the basis
of the sharing of ideas and techniques by colleagues of
diverse backgrounds. The particular discovery that I
D.J. Selkoe / Amyloid -peptide is produced by cultured cells during normal metabolism: A reprise
167
Fig. 3. A hypothetical model of the pathogenesis of Alzheimers disease based on currently available information.
[8]
[9]
References
[10]
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[11]
[12]
[13]
[14]
[15]
168
[16]
D.J. Selkoe / Amyloid -peptide is produced by cultured cells during normal metabolism: A reprise
A. Grubb, O. Jensson, G. Gudmundsson, A. Arnason, H. Loefberg and J. Malm, Abnormal metabolism of gamma-trace alkaline microprotein. The basic defect in hereditary cerebral
hemorrhage with amyloidosis, N. Engl. J. Med. 311 (1984)
1547-1549.
[17] M. Citron, T. Oltersdorf, C. Haass, L. McConlogue, A.Y.
Hung, P. Seubert, C. Vigo-Pelfrey, I. Lieberburg and D.J.
Selkoe, Mutation of the -amyloid precursor protein in familial Alzheimers disease increases -protein production, Nature
360 (1992) 672-674.
[18] X.-D. Cai, T.E. Golde and G.S. Younkin, Release of excess
amyloid protein from a mutant amyloid protein precursor,
Science 259 (1993) 514-516.
Tau
171
1. Introduction
One hundred years ago, Alos Alzheimer described
in a meeting the disease, a work that was published a
year later [2]. In the description, he indicates the presence of two aberrant structures. Today, we know those
structures like senile plaques (SP) and neurofibrillary
tangles (NFT). Later on, he wrote . . . the plaques are
not the cause of senile dementia, but only an accompanying feature of senile involution of the central nervous
system [3], suggesting that the other structures were
involved in the dementia, as suggested more recently
by other authors [4].
The discovery of the main component of senile
plaques (always, historically, the plaques were ahead of
the tangles) was done in 1984 by Glenner and Wong [5],
and at that time almost nothing was known about the
component of NFT except that they were composed of
paired helical filaments (PHF), as described for the first
time by Kidd [6].
Two years later, and after several efforts to characterize and isolate PHF by Iqbal and colleagues [7], the
first knowledge about the composition of NFT arises.
1986 was a good year in the identification of NFT
components. In a pioneer paper Grundke-Iqbal et al. [8]
described that tau was a component of PHF (tau is a microtubule associated protein discovered by Kirschners
group [9]). The observation of Iqbal et al was further
supported by two other papers published in the same
issue of PNAS [10,11], and by other work published
in Japan [12]. Also, another manuscript by GrundkeIqbal et al. [13], described that tau, in PHF, was in
hyperphosphorylated form. Additionally, during that
year it was commented a previous publication by Brion
et al. [14] that also suggested the presence of tau in
PHF. Also in 1986, it has been described that antibodies
against PHF reacted with a 68 kD protein [15]. Some
years later this protein was identified like hyperphosphorylated tau [16].
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
172
2. The article
Almost at the end of 1986 it was already clear that
tau was a component of PHF. However, to prove that
it was the main component of PHF, which is involved
in making the scaffold of the PHF, it must show that
it polymerizes into PHF-like filaments. The objective
of the work that is commented in this review was to
know if tau was able to polymerize into fibrillar PHFlike polymers. The title of the manuscript was: Selfassembly of microtubule associated protein tau into
filaments ressembling to those found in Alzheimers
disease by E. Montejo de Garcini, L. Serrano and
me, and it was published in Biochem. Biophys. Res.
Commun. 141, 790796, in 1986.
In that report [17], it was suggested that tau was not
only a component of PHF but the main component.
Also, it was suggested that tau polymerization can be
facilitated by deamidation. Some years later, Watanabe
et al. [18] described deamidation in tau from paired
helical filaments.
173
A. Alzheimer, Uber
eine eigenartige Erkrankung der Hirninde,
Z. Psychiatr, Psych. Gerichtl. Med. 64 (1907), 146148.
[3] A. Alzheimer, Ueber eigenartige Krankheitsfaelle des
spaeteren Alters, Zeitschrift fuer die gesamte, Neurologie und
Psychiatrie 4 (1911), 256286.
[4] P.V. Arriagada, J.H. Growdon, E.T. Hedley-Whyte and B.T.
Hyman, Neurofibrillary tangles but not senile plaques parallel
duration and severity of Alzheimers disease, Neurology 42
(1992), 631639.
[5] G.G. Glenner and C.W. Wong, Alzheimers disease: initial
report of the purification and characterization of a novel cerebrovascular amyloid protein, Biochem. Biophys. Res. Commun. 120 (1984), 885890.
[6] M. Kidd, Paired helical filaments in electron microscopy of
Alzheimers disease, Nature 197 (1963), 192193.
[7] K. Iqbal, T. Zaidi, C.H. Thompson, P.A. Merz and H.M. Wisniewski, Alzheimer paired helical filaments: bulk isolation,
solubility, and protein composition, Acta Neuropathol (Berl)
62 (1984), 167177.
[8] I. Grundke-Iqbal, K. Iqbal, M. Quinlan, Y.C. Tung, M.S. Zaidi
and H.M. Wisniewski, Microtubule-associated protein tau. A
component of Alzheimer paired helical filaments, J Biol Chem
261 (1986), 60846089.
[9] M.D. Weingarten, A.H. Lockwood, S.Y. Hwo and M.W.
Kirschner, A protein factor essential for microtubule assembly,
Proc Natl Acad Sci USA 72 (1975), 18581862.
[10] J.G. Wood, S.S. Mirra, N.J. Pollock and L.I. Binder, Neurofibrillary tangles of Alzheimer disease share antigenic determinants with the axonal microtubule-associated protein tau (tau),
Proc Natl Acad Sci USA 83 (1986), 40404043.
[11] K.S. Kosik, C.L. Joachim and D.J. Selkoe, Microtubuleassociated protein tau (tau) is a major antigenic component of
paired helical filaments in Alzheimer disease, Proc Natl Acad
Sci USA 83 (1986), 40444048.
[12] Y. Ihara, N. Nukina, R. Miura and M. Ogawara, Phosphorylated tau protein is integrated into paired helical filaments
in Alzheimers disease, J Biochem (Tokyo) 99 (1986), 1807
1810.
174
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[50]
[51]
[52]
[53]
[54]
175
177
1. Introduction
Neurofibrillary tangles (NFT) were first described
by Alos Alzheimer in his seminal paper describing the
pathological findings in a demented woman aged 51 [2],
using Bielschowsky silver staining. Alzheimers disease (AD) was initially considered as a rare disease,
belonging to the group of presenile dementia, until de Corresponding author: Dr Jean-Pierre Brion, Laboratory of Histology and Neuropathology, Universite Libre de Bruxelles, School
of Medicine. 808, route de Lennik, Bldg C-10, 1070 Brussels,
Belgium. Tel.: +32 2 5556505; Fax: +32 2 5556285; E-mail:
jpbrion@ulb.ac.be.
tailed anatomoclinical studies indicated that the characteristics lesions of the disease, senile plaques and NFT,
are also common in patients with senile dementia and
thus that these conditions constitute a common pathological entity, e.g. [89]. After their initial description,
little progress was made for the following decades in
the analysis of the molecular composition of NFT, with
the exception of the demonstration of their affinity for
amyloid dyes, i.e. Congo red, giving a green birefringence when observed under crossed polarization filters [28], suggesting that they were made of orderly
arranged subunits.
The early studies of NFT were devoted to the analysis
of their unusual ultrastuctural characteristics, their pe-
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
178
J.-P. Brion / Immunological demonstration of tau protein in neurofibrillary tangles of Alzheimers disease
culiar biochemical properties and their antigenic composition. Many scientists have contributed to this exciting research avenue. Our own contribution to the
initial identification of the molecular components (tau
proteins) of NFT is summarized below, tentatively in
the frameship of previous works that paved the way
towards our own studies and subsequent works by our
and other research groups.
2. Ultrastructural studies
A new leap in the description of NFT came with the
advent of ultrastructural studies in electron microscopy
in the early sixties. These studies showed that NFT
were composed of bundles of filaments. These filaments were described as paired helical filaments [60],
twisted filaments or tubules [52,87,88]. These filaments were also found in abnormal neurites in senile
plaques [41,88]. The term paired helical filaments
(PHF) is now widely used to describe them [93]. Subsequent studies by negative staining showed that they
contained a filamentous substructure [10,92]. Sophisticated ultrastructural studies have however revealed
their complex internal structure [21,82,90].
J.-P. Brion / Immunological demonstration of tau protein in neurofibrillary tangles of Alzheimers disease
179
180
J.-P. Brion / Immunological demonstration of tau protein in neurofibrillary tangles of Alzheimers disease
Fig. 1. Immunoabelling on a tissue section of the hippocampus of an AD patient with an antibody to rat tau proteins (A and B) and an antibody
to isolated PHF (C and D). The antibodies label only NFT in neurons and in dystrophic neurites in senile plaques, as shown in light microscopy
(A and C). The abnormal PHF are also labelled by the antibodies in electron microscopy (immunogold method) (B and D). Reprinted from Arch.
Biol. (Brux) 95 (1985), 229235.
J.-P. Brion / Immunological demonstration of tau protein in neurofibrillary tangles of Alzheimers disease
181
Fig. 2. Isolated PHF from an AD patient, observed in electron microscopy after simple negative staining (A) and after immunolabeling with the
original anti-tau antibody to rat tau proteins, used in reference [16]. Scale bar: 100 nm.
7. Modelization of NFT
In vitro aggregation of tau in filamentous, PHF-like
structures, has been accomplished early [72] and factors affecting this aggregation have been identified [7,
38]. Unexpectedly, several groups including us observed that simple overexpression of wild-type tau in
transgenic mice was insufficient to generate NFT [18,
42]. Recent findings however suggest that endogenous
murine tau might inhibit NFT formation [5]. The discovery of pathogenic tau mutations in familial forms
of frontotemporal dementias [53,84] has fuelled numerous studies aimed at understanding the pathogenic
role of these fibrillary lesions and their modelization
in cellular and transgenic models. Overexpression of
these mutated tau proteins in transgenic animals almost
systematically leads to formation of NFT with many
of the ultrastructural, biochemical and antigenic properties of human NFT [43]. Others and we observed
that expression of some mutants tau affects microtubule
assembly [25], a potential loss of function property
that could play a role in neuronal dysfunction in these
diseases.
182
J.-P. Brion / Immunological demonstration of tau protein in neurofibrillary tangles of Alzheimers disease
expected result in the frameship of the amyloid cascade [8]. However, A seems to boost NFT formation
if the latter are forced to develop at a basic level,
as observed in double transgenic animals developing
A deposits and expressing mutant tau proteins [66].
These tau mutations have however not been identified
in AD, and in a perfect model of AD lesions it would
be expected that NFT will be generated from wild-type
tau proteins in presence of A amyloid.
Alzheimers disease has, and will still be, a fascinating example of a relatively neglected disease to a major neurobiological research theme. To much extent,
it has propelled the interest of the research community
for neurodegenerative diseases and the search for the
understanding and the treatment of these devastating
diseases.
[8]
[9]
[10]
[11]
[12]
[13]
[14]
Acknowledgements
The author thanks the belgian F.R.S.M. for its continuous support, the International Alzheimer Research
Foundation and Alzheimer Belgique.
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
J.-P. Brion / Immunological demonstration of tau protein in neurofibrillary tangles of Alzheimers disease
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
183
associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimers disease, Neuron 3 (1989), 519
526.
M. Goedert, C.M. Wischik, R.A. Crowther, J.E. Walker and A.
Klug, Cloning and sequencing of the cDNA encoding a core
protein of the paired helical filament of Alzheimer disease:
identification as the microtubule-associated protein tau, Proc.
Natl. Acad. Sci. USA 85 (1988), 40514055.
N.K. Gonatas, W. Anderson and I. Evangelista, The contribution of altered synapses in the senile plaque: an electron
microscopic study in Alzheimers dementia, J. Neuropathol.
Exp. Neurol. 26 (1967), 2539.
J. Gotz, A. Probst, M.G. Spillantini, T. Schafer, R. Jakes, K.
Burki and M. Goedert, Somatodendritic localization and hyperphosphorylation of tau protein in transgenic mice expressing the longest human brain tau isoform, EMBO J. 14 (1995),
13041313.
J. Gotz, J.R. Streffer, D. David, A. Schild, F. Hoerndli, L.
Pennanen, P. Kurosinski and F. Chen, Transgenic animal models of Alzheimers disease and related disorders: Histopathology, behavior and therapy, Molecular Psychiatry 9 (2004),
664683.
I. Grundke-Iqbal, K. Iqbal, M. Quinlan, Y.C. Tung, M.S. Zaidi
and H.M. Wisniewski, Microtubule-associated protein tau:
a component of Alzheimer paired helical filaments, J. Biol.
Chem. 261 (1986), 60846089.
I. Grundke-Iqbal, K. Iqbal, Y.C. Tung, M. Quinlan, H.M.
Wisniewski and L.I. Binder, Abnormal phosphorylation of the
microtubule-associated protein tau in Alzheimer cytoskeletal
pathology, Proc. Natl. Acad. Sci. USA 83 (1986), 49134917.
I. Grundke-Iqbal, K. Iqbal, Y.C. Tung, G.P. Wang and
H.M. Wisniewski, Alzheimer paired helical filaments: crossreacting polypeptides normally present in brain, Acta Neuropathol. (Berl.) 66 (1985), 5261.
I. Grundke-Iqbal, K. Iqbal, Y.C. Tung and H.M. Wisniewski,
Alzheimer paired helical filaments: immunochemical identification of polypeptides, Acta Neuropathol (Berl) 62 (1984),
259267.
I. Grundke-Iqbal, A.B. Johnson, H.M. Wisniewski, R.D. Terry
and K. Iqbal, Evidence that Alzheimer neurofibrillary tangles
originate from neurotubules, Lancet 1 (1979), 578580.
D.P. Hanger, J.P. Brion, J.M. Gallo, N.J. Cairns, P.J.
Luthert and B.H. Anderton, Tau in Alzheimers disease and
Downs syndrome is insoluble and abnormally phosphorylated, Biochem. J. 275 (1991), 99104.
D.P. Hanger, K. Hughes, J.R. Woodgett, J.P. Brion and B.H.
Anderton, Glycogen synthase kinase-3 induces Alzheimers
disease-like phosphorylation of tau: generation of paired helical filaments epitopes and neuronal localization of the kinase,
Neurosci. Lett. 147 (1992), 5862.
B.J. Hempen and J.P. Brion, Reduction of acetylated -tubulin
immunoreactivity in neurofibrillary tangle-bearing neurones
in Alzheimers disease, J. Neuropathol. Exp. Neurol. 55
(1996), 964972.
A. Hirano, H.M. Dembitzer, L.T. Kurland and H.M. Zimmerman, The fine structure of some intraganglionic alterations.
Neurofibrillary tangles, granulovacuolar bodies and rod-like
structures as seen in Guam amyotrophic lateral sclerosis and
Parkinsonism-dementia complex, J. Neuropathol. Exp. Neurol. 27 (1968), 167182.
M. Hutton, C.L. Lendon, P. Rizzu, M. Baker, S. Froelich, H.
Houlden, S. Pickering-Brown, S. Chakraverty, A. Isaacs, A.
Grover, J. Hackett, J. Adamson, S. Lincoln, D. Dickson, P.
Davies, R.C. Petersen, M. Stevens, E. De Graaff, E. Wauters,
184
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
J.-P. Brion / Immunological demonstration of tau protein in neurofibrillary tangles of Alzheimers disease
J. Van Baren, M. Hillebrand, M. Joosse, J.M. Kwon and P.
Nowotny, Association of missense and 5-splice-site mutations in tau with the inherited dementia FTDP-17, Nature 393
(1998), 702705.
Y. Ihara, C. Abraham and D. Selkoe, Antibodies to paired helical filaments in Alzheimers disease do not recognize normal
brain proteins, Nature 304 (1983), 727730.
Y. Ihara, N. Nukina, R. Miura and M. Ogawara, Phosphorylated tau protein is integrated into paired helical filaments in
Alzheimers disease, J. Biochem. 99 (1986), 18071810.
Y. Ihara, N. Nukina, H. Sugita and Y. Toyokura, Staining
of Alzheimers neurofibrillary tangles with antiserum againt
200 K component fo neurofilament, Proc Jpn Acad 157 (1981),
152156.
K. Iqbal, I. Grundke-Iqbal, T. Zaidi, P.A. Merz, G.Y. Wen, S.S.
Shaikh and H.M. Wisniewski, Defective brain microtubule
assembly in Alzheimers disease, Lancet i (1986), 421426.
K. Iqbal, T. Zaidi, C.H. Thompson, P.A. Merz and H.M. Wisniewski, Alzheimer paired helical filaments: bulk isolation,
solubility, and protein composition, Acta Neuropathol. (Berl.)
62 (1984), 167178.
T. Ishii, S. Haga and S. Tokutake, Presence of neurofilament
protein in Alzheimers neurofibrillary tangles (ANT). An immunofluorescent study, Acta Neuropathol (Berl) 48 (1979),
105112.
M. Kidd, Paired helical filaments in electron microscopy of
Alzheimers disease, Nature 197 (1963), 192193.
K.S. Kosik, L.K. Duffy, M.M. Dowling, C. Abraham, A. McCluskey and D.J. Selkoe, Microtubule-associated protein 2:
monoclonal antibodies demonstrate the selective incorporation of certain epitopes into Alzheimer neurofibrillary tangles,
Proc. Natl. Acad. Sci. USA 81 (1984), 79417945.
K.S. Kosik, C.L. Joachim and D.J. Selkoe, The microtubuleassociated protein, tau, is a major antigenic component of
paired helical filaments in Alzheimers disease, Proc. Natl.
Acad. Sci. USA 83 (1986), 40444048.
H. Ksiezak-Reding, L.I. Binder and S.H. Yen, Alzheimer disease proteins (A68) share epitopes with tau but show distinct
biochemical properties, J. Neurosci. Res. 25 (1990), 420430.
H. Ksiezak-Reding, D.W. Dickson, P. Davies and S.H. Yen,
Recognition of tau epitopes by anti-neurofilament antibodies that bind to Alzheimer neurofibrillary tangles, Proc. Natl.
Acad. Sci. USA 84 (1987), 34103414.
V.M.Y. Lee, B.J. Balin, L. Otvos and J.Q. Trojanowski, A68
proteins are major subunits of Alzheimer disease paired helical
filaments and derivatized forms of normal tau, Science 251
(1991), 675678.
J. Lewis, D.W. Dickson, W.L. Lin, L. Chisholm, A. Corral, G.
Jones, S.H. Yen, N. Sahara, L. Skipper, D. Yager, C. Eckman,
J. Hardy, M. Hutton and E. McGowan, Enhanced neurofibrillary degeneration in transgenic mice expressing mutant tau
and APP, Science 293 (2001), 14871491.
G. Lindwall and R.D. Cole, Phosphorylation affects the ability
of tau protein to promote microtubule assembly, J. Biol. Chem.
259 (1984), 53015306.
S. Lovestone, C.H. Reynolds, D. Latimer, D.R. Davis, B.H.
Anderton, J.-M. Gallo, D. Hanger, S. Mulot, B. Marquardt, S.
Stabel, J.R. Woodgett and C.C.J. Miller, Alzheimers diseaselike phosphorylation of the microtubule-associated protein tau
by glycogen synthase kinase-3 in transfected mammalian cells,
Curr. Biol. 4 (1994), 10771086.
E.-M. Mandelkow, G. Drewes, J. Biernat, N. Gustke, J. Van
Lint, J.R. Vandenheede and E. Mandelkow, Glycogen syn-
[70]
[71]
[72]
[73]
[74]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
thase kinase-3 and the Alzheimer-like state of microtubuleassociated protein tau, FEBS Lett. 314 (1992), 315321.
A. Mareck, A. Fellous, J. Francon and J. Nunez, Changes in
composition and activity of microtubule-associated proteins
during brain development, Nature 284 (1980), 353355.
C.C.J. Miller, J.P. Brion, R. Calvert, T.K. Chin, P.A.M. Eagles,
M.J. Downes, M. Haugh, J. Kahn, A. Probst, J. Ulrich and B.H.
Anderton, Alzheimer paired helical filaments share epitopes
with neurofilaments side arms, EMBO J. 5 (1986), 269276.
E. Montejo de Garcini, L. Serrano and J. Avila, Self assembly
of microtubule associated protein tau into filaments resembling those found in Alzheimer disease, Biochem Biophys Res
Commun 141 (1986), 790796.
H. Mori, J. Kondo and Y. Ihara, Ubiquitin is a component of
paired helical filaments in Alzheimers disease, Science 235
(1987), 16411644.
N. Nukina and Y. Ihara, Immunocytochemical study on senile
plaques in Alzheimers disease, Proc. Jap. Acad. 59 (1983),
284292.
N. Nukina and Y. Ihara, One of the antigenic determinants of
paired helical filaments is related to tau protein, J. Biochem.
99 (1986), 15411544.
N. Nukina, K.S. Kosik and D.J. Selkoe, Recognition of
Alzheimer paired helical filaments by monoclonal neurofilament antibodies is due to crossreaction with tau protein, Proc.
Natl. Acad. Sci. USA 84 (1987), 34153419.
M. Perez, R. Cuadros, M.A. Smith, G. Perry and J. Avila,
Phosphorylated, but not native, tau protein assembles following reaction with the lipid peroxidation product, 4-hydroxy-2nonenal, FEBS Lett. 486 (2000), 270274.
G. Perry, R. Friedman, G. Shaw and V. Cahu, Ubiquitin is
detected in neurofibrillary tangles and senile plaque neurites
of Alzheimer disease brains, Proc. Natl. Acad. Sci. USA 84
(1987), 30333036.
G. Perry, N. Rizzuto, L. Autilio-Gambetti and P. Gambetti,
Paired helical filaments from Alzheimer disease patients contain cytoskeletal components, Proc. Natl. Acad. Sci. USA 82
(1985), 39163920.
A. Probst, D. Langui, C. Lautenschlager, J. Ulrich, J.P. Brion
and B.H. Anderton, Progressive supranuclear palsy: extensive
neuropil threads in addition to neurofibrillary tangles, Acta
Neuropathol. (Berl.) 77 (1988), 6168.
S. Richard, J.P. Brion, A.M. Couck and J. FlamentDurand, Accumulation of smooth endoplasmic reticulum in
Alzheimers disease: new morphological evidence of axoplasmic flow disturbances, J. Submicrosc. Cytol. 21 (1989),
461467.
G.C. Ruben, K. Iqbal, I. Grundke-Iqbal, H.M. Wisniewski,
T.L. Ciardelli and J.E. Johnson, Jr., The microtubuleassociated protein tau forms a triple-stranded left-hand helical
polymer, J. Biol. Chem. 266 (1991), 2201922027.
D.J. Selkoe, Y. Ihara and F.J. Salazar, Alzheimers disease:
insolubility of partially purified paired helical filaments in
sodium dodecyl sulfate and urea, Science 215 (1982), 1243
1245.
M.G. Spillantini, J.R. Murrell, M. Goedert, M.R. Farlow, A.
Klug and B. Ghetti, Mutation in the tau gene in familial multiple system tauopathy with presenile dementia, Proc. Natl.
Acad. Sci. USA 95 (1998), 77377741.
N.H. Sternberger, L.A. Sternberger and J. Ulrich, Aberrant
neurofilament phosphorylation in Alzheimers disease, Proc.
Natl. Acad. Sci. USA 82 (1985), 42744276.
A. Takashima, K. Noguchi, K. Sato, T. Hoshino and K. Imahori, tau protein kinase I is essential for amyloid -protein-
J.-P. Brion / Immunological demonstration of tau protein in neurofibrillary tangles of Alzheimers disease
[87]
[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
185
187
1. Introduction
First of all, scientists do not forget that Alzheimer s
disease (AD) is a devastating disease, not only for the
patient, but also for the family. But from a scientific
point of view, AD is an exciting field of research. At
present, we know that this disease is more complicated
than expected, with numerous risk factors. Therefore
finding the right lead of research for the scientist working in the Alzheimer field is quite a challenge.
AD is a very complicated disease at the physiopathological level. This was observed by Alois Alzheimer
himself who discovered this organic dementing disease
with two types of lesions: tangles inside neurons and
plaques outside, in the vicinity of degenerating neurons.
Alois Alzheimer was probably aware of the importance
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
188
rofibrillary degeneration (NFD), along a precise pathway, from the entorhinal and hippocampal formation
towards polymodal association then primary brain regions [7]. Alzheimer dementia is observed when a
threshold of neurofibrillary degeneration in the association cortical areas is reached, corresponding to
stages IV to VI [8].
The role of tangles to explain Alzheimer dementia
was so obvious that the Braak stages were incorporated
in the consensus criteria for a definite diagnosis of AD
in 1997 [9], in addition to the CERAD criteria based
only on the number of amyloid plaques.
blots, we have been able to detect and quantify abnormal tau species in AD brains, in that they are aggregated, hyperphosphorylated and abnormally phosphorylated [10], in good agreement with the results of
Brion [11] and Iqbal [12]. In addition, we were able to
demonstrate that tau proteins in AD are reliable markers of the degenerating process. First we were able to
detect two abnormal bands in neocortical areas (Tau 64
and 68) [13], then a third one using more specific antibodies (Tau 60) [14]. These pathological Tau bands
were specifically detected by an anti-PHF absorbed
with normal tau proteins. The antibody Alz-50 of Peter
Davies, that detects so well neurofibrillary degeneration and a group of pathological proteins named A68,
was in fact immunostaining those abnormal tau proteins
Tau 64 and 68 [15]. This was confirmed later on by
Trojanowskis team [16]. At last, using 2D gels and our
knowledge that tau proteins contain 6 isoforms [17],
we demonstrated the presence of a minor and fourth
abnormal tau protein at 72 kDa [18] (MW are those
given in the literature these days).
Interestingly enough, using the same approach, we
demonstrated that these tau aggregates were different in
other neurodegenerative dementing disorders, and that
there is a code-bar of tauopathies. In PSP and CBD, we
observed a specific characteristic upper doublet (Tau 64
and 69), due to the aggregation of tau isoforms with 4
repeats (4R tauopathy) [19,20], while in Picks disease,
there is a lower doublet (Tau 60 and 64), resulting from
the aggregation of 3R isoforms [21,22]. Other diseases
have other tau profiles such as the singulet in myotonic
dystrophy (DM1) [23,24], and soluble tauopathy in dementia lacking distinctive histology (DLDH) [25]. For
DLDH, an heterogeneous group, it has been clearly
shown by Zhukareva et al. that a subgroup has a defect
in the synthesis of tau proteins [26].
All these specific biochemical signatures and different sets of tau isoforms aggregated in specific subsets of
neuronal populations began to demonstrate that tangles
are not this unique and late answer to different types
of neuronal insults. Indeed, many demented disorders
result from a defect of tau proteins [27]. Therefore,
the question was to determine the natural history of tau
pathology in the aging human brain that develops or
not Alzheimers disease.
189
190
S0
S1
S2
S3
S4
S5
S6
S7
S8
S9
S10
AEPP*
AEPP*
AEPP*
45
55
Biochemical staging
of tauopathy in AD
65
75
85
year s
191
Stage
1
2
3
4
5
6
7
8
9
10
192
8. Conclusion
Altogether, many converging studies show that AD
is not a pure pathology of A, nor it is a pure tauopathy. We propose the following definition: AD is a
tauopathy fueled by APP dysfunction. The natural
and molecular history of sporadic AD shows that both
APP and tau are equally involved in the etiopathogenesis (Fig. 1). Both are also therapeutic targets and the
good news is that APists and tauoists must work together. From observations of the human brain, relevant
animal models are most likely those that demonstrate a
synergy between APP and tau lesions. Some interesting models have already been described [41,42]. Another one with a severe neuronal loss is also interesting
to understand the loss of function of APP as well as
the role of intracellular A deposition [43].
At last, one can see that most dementing neurodegenerative disorders are tauopathies, that most demented
patients have a tau pathology in neocortical areas and
that many different types of tau dysfunction lead to
dementia: mutations on tau gene in FTDP-17 (fronto
temporal dementia with Parkinsonism linked to chromosome 17) [44], the haplotype H1H1 which is a risk
factor for PSP and CBD [45], the abnormal tau splicing
[15]
[16]
[17]
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
193
194
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
195
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
196
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
197
198
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
1
1
352
381
410
199
383
412
441
200
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
201
Fig. 5. Immunoelectron microscopy of dispersed paired helical filament preparations, showing the presence of full-length tau and that the N- and
C-termini are cleaved by mild pronase treatment. (a), (c), (e) and (g) represent native material; in (b), (d), (f) and (h) the grids were treated with
pronase prior to immunodecoration. The antibodies used were as follows: 133, which recognizes the N-terminus of tau (a and b); 134, which
recognizes the C-terminus of tau; 135, which recognizes the microtubule-binding repeat region of tau (e and f); 6423, which recognizes tau
truncated at residue 391 (g and h). Some straight filaments are indicated (S). Note immunodecoration of some but not all filaments with antiserum
133 in (a), of almost all filaments with antiserum 134 in (c), and of almost all filaments with antibody 6423 in (h). Antiserum 135 failed to
decorate filaments (e and f). Scale bar, 100 nm. Reprinted from Goedert et al., Neuron 8, 159168 (1992), with permission from Elsevier.
202
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
Fig. 6. Immunohistochemical localisation of neurofibrillary pathology using phosphorylation-dependent anti-tau antibodies. (a,c,e), Cerebral
cortex from a sporadic Alzheimers disease case. (b,d,f), Cerebral cortex from a case of frontotemporal dementia and parkinsonism linked to
chromosome 17 (FTDP-17) with the V337M mutation in the tau gene. The phosphorylation-dependent anti-tau antibodies were: (a,b), AT8
(pS202 and pT205), (c,d), AT100 (pT212 and pS214) and (e,f), AT180 (pT231). The arrows in (a), (c) and (e) point to neuritic plaques, which
are characteristic of Alzheimers disease. Cases of FTDP-17 lack significant plaque pathology. Scale bar, 50 m. Reprinted from Spillantini et
al., Acta Neuropathologica 92, 4248 (1996), with permission from Springer.
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
203
Table 1
Diseases in which tau deposits have been described
Alzheimers disease
Amyotrophic lateral sclerosis/parkinsonism-dementia complex
Argyrophilic grain disease
Autosomal-dominant Parkinsons disease
Autosomal-dominant parkinsonism
Autosomal-recessive juvenile parkinsonism
Corticobasal degeneration
Dementia pugilistica
Diffuse neurofibrillary tangles with calcification
Downs syndrome
Familial British dementia
Frontotemporal dementia and parkinsonism linked to chromosome 17
Gerstmann-Straussler-Scheinker disease
Guadeloupean parkinsonism
Hallervorden-Spatz disease
Myotonic dystrophy
Niemann-Pick disease, type C
Non-Guamanian motor neuron disease with neurofibrillary
tangles
Picks disease
Postencephalitic parkinsonism
Prion protein cerebral amyloid angiopathy
Progressive subcortical gliosis
Progressive supranuclear palsy
Subacute sclerosing panencephalitis
Tangle only dementia
vided clues regarding the mechanisms of filament formation. However, it did not provide any direct information about the relevance of tau dysfunction and
filament formation for the disease process. This had
been suspected to be the case, largely because of the
good correlation between neurofibrillary pathology and
nerve cell degeneration [3,8,10]. However, the identification in 1991 and 1995, respectively, of causative
mutations in the amyloid -protein precursor gene and
the presenilin genes in familial cases of Alzheimers
disease [33,72,81,93,95], led many to believe that taupositive inclusions were epiphenomena of little or no
204
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
[14]
[15]
[16]
[17]
References
[18]
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
A. Alzheimer, Uber
eine eigenartige Erkrankung der Hirnrinde, Allg Z Psychiat Psych Gerichtl Med 64 (1907), 146
148.
A. Alzheimer, Uber
eigenartige Krankheitsfalle des spateren
Alters, Z Ges Neurol Psychiat 4 (1911), 356385.
P.V. Arriagada, J.H. Growdon, E.T. Hedley-White and B.T.
Hyman, Neurofibrillary tangles but not senile plaques parallel
duration and severity of Alzheimers disease, Neurology 42
(1992), 631639.
M. Baker, I. Litvan, H. Houlden, J. Adamson, D. Dickson,
J. Perez-Tur, J. Hardy, T. Lynch, E. Bigio and M. Hutton,
Association of an extended haplotype in the tau gene with
progressive supranuclear palsy, Hum Mol Genet 8 (1999),
711715.
J. Berriman, L.C. Serpell, K.A. Oberg, A.L. Fink, M. Goedert
and R.A. Crowther, Tau filaments from human brain and
from in vitro assembly of recombinant protein show cross-
structure, Proc Natl Acad Sci USA 100 (2003), 90349038.
G. Blessed, B.E. Tomlinson and M. Roth, The association between quantitative measures of dementia and of senile change
in the cerebral grey matter of elderly subjects, Brit J Psychiat
114 (1968), 797811.
P. Blocq and G. Marinesco, Sur les lesions et la pathogenie
de lepilepsie dite essentialle, Sem Med 12 (1892), 445446.
W. Bondareff, C.M. Wischik, M. Novak, W.B. Amos, A.
Klug and M. Roth, Molecular analysis of neurofibrillary degeneration in Alzheimers disease, Am J Pathol 137 (1990),
711723.
W. Bondareff, C.Q. Mountjoy, C.M. Wischik, D.L. Hauser,
L.D. LaBree and M. Roth, Evidence of subtypes of
Alzheimers disease and implications for etiology, Arch Gen
Psychiat 50 (1993), 350356.
H. Braak and E. Braak, Neuropathological staging of
Alzheimer-related changes, Acta Neuropathol 82 (1991),
239259.
G.T. Bramblett, M. Goedert, R. Jakes, S.E. Merrick. J.Q. Trojanowski and V.M.-Y. Lee, Abnormal tau phosphorylation
at Ser396 in Alzheimers disease recapitulates development
and contributes to reduced microtubule binding, Neuron 10
(1993), 10891099.
J.P. Brion, H. Passareiro, J. Nunez and J. Flament-Durand,
Mise en e vidence immunologique de la proteine tau au niveau
des lesions de degenerescence neurofibrillaire de la maladie
dAlzheimer, Arch Biol 95 (1985), 229235.
D.W. Cleveland, S.-Y. Hwo and M.W. Kirschner, Physical
and chemical properties of purified tau factor and the role of
tau in microtubule assembly, J Mol Biol 116 (1977), 227
247.
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
205
206
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[74]
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
M. Kidd, Alzheimers disease an electron microscopical
study, Brain 87 (1964), 307320.
S. Kobayashi, K. Ishiguro, A. Omori, M. Takamatsu, M.
Atioka, K. Imahori and T. Uchida, A cdc-related kinase
PSSALRE/cdk5 is homologous with the 30 kDa subunit of
tau protein kinase II, a proline-directed protein kinase associated with microtubules, FEBS Lett 335 (1993), 171175.
J. Kondo, T. Honda, H. Mori, Y. Hamada, R. Miura, M.
Ogawara and Y. Ihara, The carboxyl third of tau is tightly
bound to paired helical filaments, Neuron 1 (1988), 827834.
K.S. Kosik, L.K. Duffy, M.M. Dowling, C.R. Abraham, A.
McCluskey and D.J. Selkoe, Microtubule-associated protein
2: monoclonal antibodies demonstrate the selective incorporation of certain epitopes into Alzheimer neurofibrillary
tangles, Proc Natl Acad Sci USA 81 (1984), 79417945.
K.S. Kosik, C.L. Joachim and D.J. Selkoe, Microtubuleassociated protein tau is a major antigenic component of
paired helical filaments in Alzheimers disease, Proc Natl
Acad Sci USA 83 (1986), 40444048.
E. Kraepelin, Psychiatrie. Ein Lehrbuch fur Studierende und
Arzte,
II. Band, Klinische Psychiatrie. Verlag Johann Ambrosius Barth, Leipzig 1910.
H. Ksiezak-Reding, D.W. Dickson, P. Davies and S.-H. Yen,
Recognition of tau epitopes by anti-neurofilament antibodies
that bind to Alzheimer neurofibrillary tangles, Proc Natl Acad
Sci USA 84 (1987), 34103414.
H. Ksiezak-Reding, K. Morgan, L.A. Mattiace, P. Davies,
W.K. Liu, S.-H. Yen, K. Weidenheim and D.W. Dickson,
Ultrastructure and biochemical composition of paired helical filaments in corticobasal degeneration, Am J Pathol 145
(1994), 14961508.
G. Lee, N. Cowan and M.W. Kirschner, The primary structure
and heterogeneity of tau protein from mouse brain, Science
239 (1988), 285288.
G. Lee, R.L. Neve and K.S. Kosik, The microtubule binding
domain of tau protein, Neuron 2 (1989), 16151624.
V.M.-Y. Lee, B.J. Balin, L. Otvos and J.Q. Trojanowski,
A68 a major subunit of paired helical filaments and derivatized forms of normal tau, Science 251 (1991), 675678.
V.M.-Y. Lee, M. Goedert and J.Q. Trojanowski, Neurodegenerative Tauopathies, Annu Rev Neurosci 24 (2001), 1121
1159.
G. Lindwall and R.D. Cole, Phosphorylation affects the ability of tau protein to promote microtubule assembly, J Biol
Chem 259 (1984), 53015305.
G. Lindwall and R.D. Cole, The purification of tau protein
and the occurrence of two phosphorylation states of tau in
brain, J Biol Chem 259 (1984), 1224112245.
E. Levy-Lahad, W. Wasco, P. Poorkaj, D.M. Romano, J.
Oshima, W.H. Pettingell, C.E. Yu, P.D. Jondro, S.D. Schmift,
K. Wang, A.C. Crowley, Y.H. Fu, S.Y. Guenette, D. Galas, E.
Nemens, E.M. Wijsman, T.D. Bird, G.D. Schellenberg and
R.E. Tanzi, Candidate gene for the chromosome 1 familial
Alzheimers disease locus, Science 269 (1995), 973977.
E.M. Mandelkow, G. Drewes, J. Biernat, N. Gustke, J. van
Lint, J.R. Vandenheede and E. Mandelkow, Glycogen synthase kinase-3 and the Alzheimer-like state of microtubuleassociated protein tau, FEBS Lett 314 (1992), 315321.
C.L. Masters, G. Multhaup, G. Simms, J. Pottgiesser, R.N.
Martins and K. Beyreuther, Neuronal origin of cerebral amyloid: Neurofibrillary tangles of Alzheimers disease contain
the same protein as the amyloid of plaque cores and blood
vessels, EMBO J 4 (1985), 27572763.
[75]
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
[90]
A. Pick, Uber
die Beziehungen der senilen Hirnatrophie zur
Aphasie, Prager Med Wochenschr 17 (1892), 165167.
M. Pickhardt, Z. Gazova, M. von Bergen, I. Khlistunova, Y.
Wang, A. Hascher, E.M. Mandelkow, J. Biernat and E. Mandelkow, Anthraquinones inhibit tau aggregation and dissolve
Alzheimers paired helical filaments in vitro and in cells, J
Biol Chem 280 (2005), 36283635.
M. Goedert et al. / Tau protein, the paired helical filament and Alzheimers disease
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]
[102]
E. Redlich, Uber
miliare Sklerose der Hirnrinde bei seniler
Atrophie, Jahrb Psychiat Neurol 17 (1898), 208216.
E.I. Rogaev, R. Sherrington, E.A. Rogaeva, G. Levesque, M.
Ikeda, Y. Liang, H. Chi, C. Lin, K. Holman, T. Tsuda, L. Mar,
S. Sorbi, B. Nacmias, S. Piacentini, L. Amaducci, I. Chumakov, D. Cohen, L. Lannfelt, P.E. Fraser, J.M. Rommens
and P.H. St George-Hyslop, Familial Alzheimers disease in
kindreds with missense mutations in a gene on chromosome
1 related to the Alzheimers disease type 3 gene, Nature 376
(1995), 775778.
R. Rubenstein, R.J. Kascsak, P.A. Merz, H.M. Wisniewski,
R.I. Carp and K. Iqbal, Paired helical filaments associated
with Alzheimer disease are readily soluble structures, Brain
Res 372 (1986), 8088.
R. Sherrington, E.I. Rogaev, Y. Liang, E.A. Rogaeva, G.
Levesque, M. Ikeda, H. Chi, C. Lin, G. Li, K. Holman,
T. Tsuda, L. Mar, J.F. Foncin, A.C. Bruni, M.P. Montesi,
S. Sorbi, I. Rainero, L. Pinessi, L. Nee, I. Chumakov, D.
Pollen, A. Brookes, P. Sanseau, R.J. Polinsky, W. Wasco,
H.A.R. da Silva, J.L. Haines, M.A. Pericak-Vance, R.E.
Tanzi, A.D. Roses, P.E. Fraser, J.M. Rommens and P.H. St
George-Hyslop, Cloning of a gene bearing missense mutations in early-onset familial Alzheimers disease, Nature 375
(1995), 754760.
M.G. Spillantini, R.A. Crowther and M. Goedert, Comparison of the neurofibrillary pathology in Alzheimers disease and familial presenile dementia with tangles, Acta Neuropathol 92 (1996), 4248.
M.G. Spillantini, M. Goedert, R.A. Crowther, J.R. Murrell,
M.J. Farlow and B. Ghetti, Familial multiple system tauopathy with presenile dementia: a disease with abundant neuronal and glial tau filaments, Proc Natl Acad Sci USA 94
(1997), 41134118.
M.G. Spillantini, T.D. Bird and B. Ghetti, Frontotemporal
dementia and parkinsonism linked to chromosome 17: a new
group of tauopathies, Brain Pathol 8 (1998), 387402.
M.G. Spillantini, J.R. Murrell, M. Goedert, M.R. Farlow, A.
Klug and B. Ghetti, Mutation in the tau gene in familial multiple system tauopathy with presenile dementia, Proc Natl
Acad Sci USA 95 (1998), 77377741.
M.G. Spillantini, R.A. Crowther, W. Kamphorst, P. Heutink
and J.C. van Swieten, Tau pathology in two Dutch families
with mutations in the microtubule-binding region of tau, Am
J Pathol 153 (1998), 13591363.
S. Taniguchi, N. Suzuki, M. Masuda, S. Hisanaga, T. Iwatsubo, M. Goedert and M. Hasegawa, Inhibition of heparininduced tau filament formation by phenothiazines, polyphenols and porphyrins, J Biol Chem 290 (2005), 76147623.
R.D. Terry, The fine structure of neurofibrillary tangles in
[103]
[104]
[105]
[106]
[107]
[108]
[109]
[110]
[111]
[112]
[113]
[114]
[115]
207
209
1. Introduction
When I was a resident of neurology (197375),I happened to take from the desk in a resident room a small
brochure that was distributed by a pharmaceutical company in Japan. The cover photo showed neurofibrillary
tangles (NFT) in Alzheimers disease (AD), the unusual
morphology of which so impressed me at a stage when
there was insufficient knowledge about its neuropathology. Soon I learned that their nature had been the target of modern neuropathology. I also came to learn
about an attempt by Dr Khalid Iqbal to isolate NFT and
determine their major components by SDS-PAGE. The
paper written by Dr Iqbal, though only a short communication [6], had a great impact upon many young neurologists/psychiatrists. It was probably this paper that
made young Khalid Iqbal world-famous. This is why in
1976 I joined the lab of Dr Yoshito Kaziro, Institute of
Medical Sciences, University of Tokyo, for the study of
microtubules (MT), simply because they have fibrous
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
210
211
Fig. 1. SDS-NFT under polarized light microscope. Pieces from AD cortices were homogenized in 2% SDS buffer containing 1%
-mercaptoethanol and heated to 90 C for 10 min. SDS-insoluble stuff was collected by low-speed centrifugation, and smeared on glass slides,
followed by staining with 0.1% Congo red, and viewed under polarized light. A great number of ring-shaped, globose-typed NFT maintain their
configurations and show Congo-red birefringence. Original magnification, x200. Taken from Jikken Igaku (cover; Vol 4, No 11, 1986) with
permission.
Dennis J. Selkoe. At that time, Dennis was only a newcomer, and known to only a limited number of people
for his work on aluminum-induced fibrous pathology
at Dr Shelanskis laboratory [14].
In the middle of April 1981, I arrived at Logan airport. It was a gloomy day, typical of Boston in early
spring. I picked up my luggage and stepped down the
staircase to the exit. A handsome young man was at
the end of the staircase, and whispered to me just as I
passed him, Dr Ihara. It was Dennis J Selkoe, who
was working at the Mailman Research Center, McLean
Hospital, Belmont. The next morning, Dennis and I
discussed in his very small office what I should do for
the next two years in his laboratory. Dennis showed me
a memo pad on which about twenty project titles were
listed. I replied, I have no interest in any but this.
It read purification of NFT from AD brain. It will
be difficult, said Dennis. Is that all right with you?
No problem! I replied.
It was quite a small lab. Besides Dennis, there were
only three people working there: Kenneth S. Kosik as
a post doc, Carmela Abraham as a technician, and one
more technician, who soon left the lab. A secretary
told me that it had been more than 20 years since she
had met Japanese researchers at the Folch-Pi lab. The
best thing for me was that there were many nonfixed
AD brain slices in the deep freezer that should have
contained abundant NFT: this was what had brought
me to the US. But I was a little discouraged by the poor
equipment in the research center. In particular, there
was only an old-fashioned ultracentrifuge (for example, a Beckman type L centrifuge, which I had never
seen in Japan) and no SW50.1 rotor (Beckman), which
was the most convenient for subcellular fractionation.
We borrowed a rotor from a lab at the Eunice Kennedy
Shriver Center (Waltham, MA) not far from our laboratory, but on which only two buckets could hook. I
was also surprised to see that many old machines were
carefully maintained and still working. A huge Zeiss
fluorescence microscope in the core facility was made
in the 1950s! One thing I brought to the US with me
was a mini gel system, which I had rightly thought was
not available in the US.
5. Insolubility of NFT/PHF
I started to work in the lab in the middle of May
1981. Of course, my goal was the purification of PHF
and identification of their components. At that time,
Dennis confirmed that PHF are insoluble in 2% Triton
X-100, as judged by electron microscopy and, using
the detergent, he obtained a PHF-enriched fraction, but
found no difference in the bands on 1D gel or in the
spots on 2D gel between AD and control brains. In
particular, he could not find the so-called PHF-P (PHF
protein) at 50 kD, persistently claimed to be a PHF
component [6]. Dennis was absolutely puzzled by the
conflicting observations, and I believed that the purifi-
212
Fig. 2. Purified SDS-NFT under polarized light microscope. An aliquot from 1.4/2.0 M sucrose interface was smeared on a glass slide, followed
by addition of 0.1% Congo red. Globose NFT were overwhelmed by needle-like tangles, which resemble velvet. Original magnification, x200.
Fig. 3. NFT stained specifically with an antiserum to SDS-NFT. Pieces of AD cortex were Dounce-homogenized in Tris saline (TS) buffer, followed
by differential centrifugation. Nuclear fraction was saved and aliquots were smeared on glass slides, which was processed for immunostaining
with anti-PHF. Original magnification, x200.
observation!
Now that I had a semiquantitative assay method for
NFT, I was in a position to examine each purification
step for its effectiveness quite easily. From Dennis
data, NFT were insoluble in the nonionic detergent.
I selected urea, the most frequently used denaturant,
to try differential solubilization: an old and somewhat
tricky technique. One day in June 1981, I tested the
solubility of NFT by increasing the concentrations of
urea in the NFT suspension: 2 M, 4 M, to 6 M, step
by step. Most surprisingly, 6 M urea did not solubilize NFTs in the suspension at all as judged by polarized microscopy. This was true even with 8 M urea.
I immediately moved to 6 M guanidine-HCl and 2%
SDS, and finally heated 2% SDS with or without 1%
-mercaptoethanol [15]. NFT were present with no
noticeable morphological alterations! (Fig. 1) NFT are
indeed insoluble in such harsh denaturants and detergents, which were the most commonly used reagents
to solubilize any protein. This was when I learned that
even a strong detergent that is believed to solubilize any
protein cannot bring NFT into solution. Immediately
I realized that this insolubility could explain Denniss
enigmatic observations that even PHF-enriched fraction never showed a protein that was not also found in
control brains. We had simply confirmed that in the
SDS/urea-solubilized fraction there was no significant
difference between AD and control brains. If that were
213
214
Fig. 5. Smearing of recombinant three- and four-repeat tau by prolonged incubation. Purified recombinant three- and four-repeat tau (0.1 mg/mL)
were incubated in 0.1 M sodium phosphate buffer, pH 7.4, at 37 C, under sterile conditions for 10 to 90 days. The SDS sample buffer was added
to each tube at the indicated day, followed by western blotting with TM2, a monoclonal antibody to carboxyl terminal portion of tau. Extensive
smears emerged after 20-day incubation. Four-repeat tau disappeared significantly faster than did three-repeat tau.
hot SDS buffer containing 1% -mercaptoethanol, followed by centrifugation to collect the insoluble product in which NFT should become enriched. Thus, the
insoluble stuff was further fractionated by sucrose density gradient centrifugation. PHF were mainly collected at the interface of 1.4/2.0 M. As you can see
in Fig. 2, fine or thinner bundles as well as typical
perikaryal NFT were also enriched in the interface and
showed Congo-red birefringence. When sucrose layers
were made of 1.0/1.2/1.4/1.8/2.0 M, large NFT were
recovered at the interface of 1.8/2.0 M, while needlelike NFT were exclusively seen at the 1.4/1.8 M interface. At first, I did not realize that the stuff showing
velvet-like birefringence (see Fig. 2) also represented
PHF. Only time-consuming electron microscopy confirmed my assumption. Senile plaque cores were also
insoluble in SDS, and only partial separation from PHF
was possible: cores were heavier than NFT and recovered in the 2.0 M sucrose layer below the 1.4/2.0 M
interface. Thanks to insolubility, I finally succeeded
in substantially purifying PHF, but had one problem:
protein determination. Because of the high insolubility
of PHF, conventional methods cannot be applied, and
I had to undertake an alkaline hydrolysis method that
I had never attempted before. The method took me
more than half a day for protein determination of several samples! At most, 24 mg of PHF from 1 g of wet
weight AD cortex (corresponding to 1/201/40 of the
total protein) was recovered at the 1.4/2.0 M interface.
I then moved to the next step: identification of the
PHF component. I thought that I could soon identify
the component by releasing peptides from PHF using
L-Asp
X: Pro
Leu
Ile
Val.
..
.
Asn-X
cleavage
L-Succinimide
215
L-Asp
D-Asp
L-Succinimide
D-Succinimide
X: Gly
Ala
..
..
deamidation
L-Asn
L-isoAsp
L-isoAsp
D-isoAsp
Fig. 6. Pathways for deamidation/isoaspartate formation and peptide bond cleavage through a succinimide intermediate. L-Asparaginyl residues
can be converted spontaneously via a succinimidyl intermediate to form L-isoaspartyl and L-aspartyl residues (right). This reaction tends to occur
when asparaginyl residues are followed by a small residue such as glycine. In contrast, when bulky residues, especially leucyl or prolyl residue,
follow an asparaginyl residue, the peptide bond cleavage can occur through a succinimide intermediate (left).
the final stage of DAB (3, 3-diaminobenzidine) development, Dennis and Carmela joined me just in time
to observe the result. We had no doubt we would see
in the next moment a distinct band(s) on the blot that
can be labeled by the antiserum. Somethings coming
out, shouted Carmela. Only in lanes for AD brain homogenates, but not for control homogenates, emerged
smears [4] (later we called this PHF-smear) from highmolecular weight regions to low-molecular weight regions but no discrete bands. We had no words, and it
was the first time we had seen such a peculiar western
blot pattern. This tells us something, said Dennis after a pause. I repeated the same experiments using total
homogenates (10%) and soluble fractions. The results
were the same: AD, but not control, samples always
gave strong smears and no discrete bands. Of course,
homogenates from AD cerebella did not show any reaction. In other words, smearing was a phenomenon
specific to AD cortices and for NFT abundance. I
sometimes came across several bands clustered around
216
paraginyl residues are clustered within the microtubulebinding domain of tau). Furthermore, the sequencing
of smeared tau in vivo obtained from AD brain identified similar degradation products starting from bulky
residues next to asparaginyl residues. Thus, deamidation/isomerization and nonenzymatic cleavage at asparaginyl residues through a succinimide intermediate
is the basis for smear formation on the blot, a unique
characteristic of AD brain [18]. Elucidation of the nature of the smears has taken me more than twenty years!
What is learned in the cradle is carried to the grave.
References
[1]
[14]
[15]
[16]
[17]
[18]
217
219
author.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
220
221
Table 1
Methods for Bulk Isolation of PHF
Authors
Iqbal et al., 1974 [59]
Grundke-Iqbal et al., 1981* [42]
Iqbal et al., 1984 [60]
Selkoe et al., 1982 [113]
Ihara et al., 1983 [55]
Masters et al., 1985 [91]
Rubenstein et al., 1986 [109]
Method
Nondenaturing conditions; isolation of neuronal perikarya, followed by conventional subcellular
fractionation.
Isolation of neuronal perikarya, followed by treatment with 2% SDS at room temperature for 35 min.
and sucrose density gradient centrifugations; Yield: 10100 g protein/g tissue
Differential centrifugation of tissue homogenate, followed by extraction in 2% Triton X-100; Yield:
12 mg protein/g tissue.
Boiling of tissue homogenate in 2% SDS and 0.1 M -mercaptoethanol buffered with 0.05 M Tris,
pH 7.6; Yield: 5080 g/g tissue.
Extraction of tissue homogenate with salts and Triton X-100, followed by digestion with pepsin,
sucrose discontinuous density gradient centrifugations, and extraction with 2% SDS.
Differential and rate zonal centrifugation of tissue homogenate digested with proteinase-K and
micrococcal nuclease and extracted by sonication with sarcosyl and sulfobetain 314; Yield: 0.2 g/g
tissue.
Treatment of 27,200 x g brain extract with 1% sarkosyl, followed by sedimentation at 80,000 x g
and sucrose density gradient centrifugation; Yield: 7 g/g tissue.
Isolation
of PHF employing treatment with SDS, polypeptide composition of isolated PHF and aggregation of PHF polypeptides at the top of
the gel was presented for the first time at the Annual Meeting of the American Association of Neuropathologists in 1981.
222
Fig. 2. Sodium dodecyl sulfate (SDS)-polyacrylamide slab gels showing protein patterns of: 1: purified bovine neurofilament protein (F). Mol.
Wt. of major band is 51,000; 2: total neuronal proteins from a case of senile dementia mixed with the filament protein; 3: total neuronal proteins
as in 2 but mixed with purified human brain tubulin; 4, 5, 6: total neuronal proteins respectively from a case of senile dementia, a normal adult
control, and a normal young (5-year-old) control; 7: purified human brain tubulin, -monomer, mol. Wt. 56,000, -monomer, mol. Wt. 53,000;
8: a separate but similar gel with TT-enriched fraction from another senile dementia patient. F is the major neurofilament protein subunit; T
and T are the - and -monomers of tubulin respectively; NP is a neuronal protein which migrates between the two tubulin monomers; and
EFB is the new band corresponding to the enrichment of twisted tubules. Dots on the left side of samples 2, 3, 4 and 8 indicate the position of
the band (EFB). Other differences seen in the electrophoretic patterns between diseased and control brain fractions were not consistent.
Reproduced with permission from Iqbal, et al., Brain Res. 77:337343, 1974.
223
Fig. 3. Congo red birefringence of isolated ANT. A light micrograph of ANT isolated from an Alzheinmer brain and stained with congo red
showing birefringence in polarized light; a, ANT isolated by long procedure and b, by short procedure as described in Materials and Methods. X
490.
Reproduced with permission from Iqbal et al., Acta Neuropathol. (Berl) 62:167177, 1984.
224
and development of their Western blots with antibodies to PHF had led us to patterns of molecular sizes
of MAP-tau, we had also in parallel studies pursued
the identification of the tangle-crossreacting antigen
in brain microtubules, based on our 1979 observations [40]. We observed that the tangle staining of antiPHF serum and of anti-microtubule sera could be absorbed only with tau and not with HMW MAP. However, having endured almost four years of intense controversy and arguments on the solubility of PHF, we
had become very careful not to publish any new findings without being certain of them by several forms of
evidence.
Since we had established that PHF protein was a normal brain microtubule protein other than tubulin and
HMW MAP, we purified tau from bovine brain by five
different methods. All of these tau preparations reacted
specifically with antibodies to PHF [47]. Employing
these purified tau preparations, we affinity-purified antibodies to each of the six brain tau isoforms from the
anti-PHF serum and showed that antibodies to each
tau isoform reacted with most neurofibrillary tangles
on AD brain sections and with all six tau isoforms in
normal brain tau as well as in isolated PHF on Western blots (Fig. 4). Employing PHF purified from AD
brains, we also demonstrated colocalization of the PHF
polypeptides with the six brain tau isoforms by SDSPAGE [47]. We were most excited that our systematic
approach of the previous 12 years had finally resulted
in the identification of tau as a major protein subunit of
PHF.
The immunohistochemical staining of PHF/neurofibrillary tangles with antibodies to neurofilaments [8,
25,30,67,103], vimentin [150], HMW-MAP [77], somatostatin [108], and tau [16,27,56,78,148] was observed by several laboratories. However, immunohistochemical crossreactivity between two proteins does
not necessarily allow one to assume any precursorproduct relationship. The size of an antigenic site detected by an antibody is relatively small, and identical or closely related antigenic sites comprising a few
amino acid residues have been found on molecules
that are otherwise unrelated, e.g., between the transforming proteins of Rous sarcoma virus and tubulin,
myosin, and vimentin [95]; between thymus and neuronal cell surface proteins [34]; and between rabbit IgG
and PHF/tangles [46]. Furthermore, it is not possible to
determine with immunohistochemical techniques alone
whether crossreactivities may be due to similarities in
primary amino acid sequence or to antigenic sites created from folding of different regions of a polypeptide
chain, i.e., conformation site(s) [13].
We completed our manuscript on tau by early summer of 1985. We took this manuscript and one on abnormal hyperphosphorylation of tau (see below) with
us on our vacation to Germany for final editing. We
knew we had an important discovery at hand and decided to submit our paper to Lancet. On September
20, 1985, we received acknowledgement of the receipt
of this paper from Lancet. After several days, the editor of Lancet returned our manuscript without reviews,
stating that he had a large backlog of papers and did
not want to increase this backlog with our paper. We
then submitted it to the Journal of Cell Biology, whose
reviewers suggested that we try a specialty journal. We
then submitted the paper for publication in the Journal of Biological Chemistry (J. Biol. Chem.), where
a reviewer stated that our previous paper published in
Acta Neuropathologica [45] had unmistakably shown
tau bands in Western blots of PHF. To our surprise, this
reviewer also pointed out that John Brion, in the Journal
of Submicroscopic Cytology [17], had already shown
immunohistochemical labeling of neurofibrillary tangles in AD brain with an antibody to tau. We were
shocked that we did not know of this finding, especially because John Brion and his collaborator, Flamment Durrand, had inquired of us a lot about our data
on the identification of the protein composition of PHF
at the International Neuropathology Meeting but never
mentioned that they were carrying out similar studies.
We asked our Institute librarian to get a copy of J.
Brions publication through interlibrary service. We
were greatly relieved to see this publication, because
it reported that antisera to PHF could not be absorbed
with normal brain proteins including the microtubule
preparations.
We had revised our J. Biol. Chem. manuscript
and put together a cover letter to the editor, enclosing J. Brions paper and showing that prior to us, nobody had shown the presence of tau in PHF. It was December 23, 1985, and we had a second manuscript on
abnormal hyperphosphorylation of tau ready for submission for publication in the Proceedings of the National Academy of Sciences, USA (Proc. Natl. Acad.
Sci. USA) (see below). Because of unreliable mail
during the Christmas season, we had decided to drive
to Rockefeller University, New York, NY, which is
about a 45-minute drive from our Institute, to personally submit the Proc. Natl. Acad. Sci. USA manuscript
to Philip Siekevitz, who had agreed earlier to handle
our manuscript as a member editor of the National
Academy of Sciences. We parked our car on the street
in front of Rockefeller University and put our briefcases
225
Fig. 4. Labeling of tau and PHF polypeptides on Western blots and of tangles and plaque neurites on tissue sections with antibodies purified by
immunoaffinity from five different molecular species of tau. For a, tau (Method 3) was electrophoresed on SDS-polyacrylamide gels (12.5%
acrylamide, 16 X 11 cm) and transferred to nitrocellulose paper. Strips were cut from the sides and developed with anti-MT (PHF) serum (a. MT)
and monoclonal antibody to tau (a, tau). The remaining blot was sued for affinity isolation of anti-tau antibodies from the anti-MT(PHF) serum.
Roman numerals (IV) indicate the areas of tau species from which the antibodies wre purified. For details see Materials and Methods. In b,
immunoblots of tau and PHF polypeptides with affinity-purified antibodies from tau polypeptides of areas IV are shown. Electro-transfer from
SDS gel, 710% acrylamide (8 X 6 cm). Differences in the staining intensities of the different antibodies are due to small individual viations in
the amounts of the samples applied to the gel. C shows immunocytochemical staining of tangles (some of the tangles marked with arrows) and
neurites of plaques (marked with circles) in paraffin sections of Alzheimer hippocampus with antibodies eluted from tau area I (left panel); the
background staining might correspond to the normal distribution of tau. The right panel shows at high magnification a neuron with the fibrils of
its tangle darkly stained by the antibody. Original magnifications: left panel, X 130; right panel, X 1500. Identical staining was obtained with
antibodies eluted from the other four tau areas; plaque amyloid was not stained with any of these five antibodies.
Reproduced with permission from Grundke-Iqbal et al., J. Biol. Chem. 261:60846089, 1986.
226
Fig. 5. Immunocytochemical staining with mAb to and the effect of dephosphorylation. (ac, f, g) Sections of Alzheimer hippocampus and (d,
e) temporal cortex; (h) section of hippocampus of a 80-year-old non-Alzheimer dementia individual; (i) tangle-enriched preparation that had been
washed twice with 2% (wt/vol) NaDodSO4 in a boiling water bath. (b, c, eh) Sections were dephosphorylated with alkaline phosphatase prior
to immunolabeling; (a and d) nondephosphorylated controls; adjacent sections and corresponding areas to b and e treated identically except that
the alkaline phosphatase was substituted with buffer. Numbers of immunostained tangles, plaques, and neuropil threads are very much increased
in the dephosphorylated tissue sections in b and e as compared to the control treated sections in a and d. (c) Staining of plaque neurites but not of
central core amyloid; (f) a neuron with immunolabeled tangle extending into the apical dendrite; (g) a neuron with granulovacuolar inclusions;
(h) no staining is seen in the non0Alzheimer hippocampus even after dephosphorylation. (a, b) X 75; (c, f, g, and I) X 750; (d, e) X 300; (h) X
150.
Reproduced with permission from Grundke-Iqbal et al., Proc. Natl. Acad. Sci. USA 83:49134917, 1986.
find and recalculate some data and to revise and resubmit the manuscript, which was accepted and then
was published in the May 5th, 1986, issue of J. Biol.
Chem. [47].
3. Discovery of the abnormal
hyperphosphorylation of tau
In December 1984, we attended a conference of the
New York Academy of Sciences on Dynamic Aspects
of Microtubule Biology, where Lester (Skip) I. Binder
227
Fig. 6. Immunoblots of PHF polypeptides with (lane 1) antiserum to isolated PHF, 1:1,000 dilution; (lane 2) PHF-reactive
anti-microtubule serum, 1:3,000 dilution; (lane 3) mAb to at
0.1 g/ml on dephosphorylated (*) and nondephosphorylated blots
and (lane 4) blots of PHF and neurofilament (NF) polypeptides with
mAb to NF, SMI 34, 1:10,000 dilution. (#) The dephosphorylation of PHF polypeptides on the paper blots was carried out with
alkaline phosphatase (43 g/ml) before incubation with antibody.
Preoteins were electrotransferred from NaDodSO4 /polyacrylamide
gel, 515% acrylamide gradient. Arrowheads indicate positions of
Mt markers from tot to bottom: myosin (200,000), phosphorylase
b (92,500), bovine serum albumin (68,000), ovalbumin (43,000),
-chymotrypsinogen (25,700). Not shown in this figure, even at a
10-fold increase in the antibody concentration mAb SMI 34 did not
label PHF polypeptides. The background smear and the low Mt
bands in lane 1 most probably represent oligomers and breakdown
products, respectively, of the PHF polypeptides (35); similar immunostaining pattern is obtained with mAb to PHF (5). The far left
lane shows the Coomassie blue-stained polypeptide pattern of isolated PHF (5-030T acrylamide gradient).
Reproduced with permission fro Grundke-Iqbal et al., Proc. Natl.
Acad. Sci. USA, 83:49134917, 1986.
228
Fig. 7. Western blots of microtubules assembled in vitro from a normal human brain (lanes 1 and 4) and an identically treated Alzheimer
brain (lanes 2 and 3) developed with monoclonal antibody to tau.
Reproduced with permission from Iqbal et al., Lancet 2:421426,
1986.
mortem AD and control brains. After considerable effort, we had finally worked out a program whereby we,
a local hospital, and our neuropathologist coordinated
to collect brains by six hours postmortem. Over a period of six years, we collected several AD and control
brains, mostly during off hours, and processed them for
up to two cycles of in vitro assembly of microtubules.
We observed that we could assemble microtubules from
control aged brains but not from AD brains [61]. We
could, however, assemble microtubules from both AD
and control brains by DEAE-Dextran, a polycation that
mimics tau in promoting microtubule assembly. We
traced the in vitro microtubule assembly defect in AD
brain to the presence of abnormally hyperphosphorylated tau in the cytosol (Fig. 7). This was the first study
demonstrating a functional impairment of the abnormal
hyperphosphorylation of tau in AD brain.
We discovered that, unlike normal tau, the abnormally hyperphosphorylated tau in AD brain is glycosylated and that glycan(s) maintains the helicity of PHF,
but does not have any apparent effect on the ability
of tau to promote the assembly of tubulin into microtubules [141]. Removal of glycans by enzymatic deglycosylation converted PHF into bundles of straight filaments 2.5 0.5 mm in diameter, suggesting the involvement of glycosylation in the maintenance of the
PHF structure. Subsequent studies from our laboratory
showed that the glycosylation of tau precedes its abnormal hyperphosphorylation and aggregation into PHF,
and that the glycosylation makes tau a more favorable
substrate for abnormal hyperphosphorylation [86,87,
111].
229
230
231
Fig. 8. In vitro polymerization of AD P- into tangles of PHF/SF and the effects of dephosphorylation and deglycosylation. AD P- , 0.4 mg/ml,
without treatment (a), dephosphorylated by AP (b), or deglycosylated by endoglycosidase F/N-glycosidase F (c), was incubated for 90 min, and the
products of the assembly were examined by NSEM. Dephosphorylation, but not deglycosylation, completely abolished AD P- polymerization.
Bar represents 50 nm. (Insets) PHF at higher magnifications. Arrows label examples of 1015 nm (straight) and 4 nm (arrowhead) filaments. (d)
AD P- , 0.4 mg/ml, was incubated as above to induce assembly, and the aggregated protein was separated from the non-aggregated protein by
centrifugation at 35 C and 100,000 X g for 15 min. The pellet (P) was resuspended to its original volume, and equivalent samples of the original
mixture (O), the supernatant (S), and the pellet (1, 2, and 4X) were analyzed by Western blots by using Tau0-1 antibody and dephosphorylation
of the proteins on the blot with AP. (e) The amount (mean SD of 4 values) of AD P- ?present in the original and the supernatant fractions was
quantitated by scanning the immunoblots. (f) SDS/PAGE (10% gel) of AD P- and blot of a lane from the same gel developed with Tau-1 antibody
after dephosphorylation. One strip (8 g of protein/lane) was stained with Coomassie blue (c), and another strip (2 g of protein/lane) was
stained with Tau-1 antibody after dephosphorylation of the proteins on the membrane (B). (g) For in vitro dephosphorylation and deglycosylation
of AD P- aliquots of AD P- were treated with (2) or without (1) the addition of AP to dephosphorylate (panels labeled 92e, Tau-1 and
PHF1) or endoglycosidase F/N-glycosidase F to deglycosylate (panels labeled GNA and PNA) the proteins as described. The immunoblots were
developed with 92e (dilution 1/5,000) to detect the total amount of, Tau-1 (1/50,000) to detect dephosphorylated , and PHF1 (1/250) to detect
phosphorylated . The increase in Tau-1 staining and decrease in PHF1 staining show dephosphorylation of AD P- . The immunoblots were
developed with lectin GNA or PNA to detect glycosylation. Decrease in the staining with the lectins shows deglycosylation of AD P- by the
glycosidase.
Reproduced with permission of Alonso et al., Proc. Natl. Acad. Sci. USA 98:69236928, 2001.
232
(see [65]), rather than as a result of the direct neurotoxicity of one lesion to the other, which was suggested by
the amyloid cascade hypothesis.
The state of phosphorylation of a phosphoprotein
is a function of the balance between the activities of
protein kinases and protein phosphatases that regulate its phosphorylation. Tau, which is phosphorylated
at more than 30 serine/threonine residues in AD [50,
94], is a substrate for several protein kinases [66,
116,118,120,121]. Among these kinases, glycogen
synthase kinase-3 (GSK-3), cyclin-dependent protein
kinase 5 (cdk5), protein kinase A (PKA), calcium,
calmodulin-dependent protein kinase-II (CaMKII),
mitogen-activated protein kinase ERK1/2, and stressactivated protein kinases have been implicated the most
in the abnormal hyperphosphorylation of tau (see [66]).
Our laboratory led the studies on the role of site-site
interaction in the abnormal hyperphosphorylation of
tau [89,114,117,119,123,142]. We were the first to
demonstrate that phosphorylation of tau by non-proline
dependent protein kinases PKA, PKC, CaMKII and
casein kinase-1 (CK1) primed it for subsequent phosphorylation by proline directed protein kinases (PDPK)
cdk5 and GSK-3, showed quantitative inhibition of the
binding of tau to microtubules at various sites, and
identified Ser262 and Thr231 to be the two major sites,
phosphorylation of which inhibits the binding of tau to
microtubules [115,117,119]. In collaboration with JinJing Pei (Karolinska Institute, Stockholm, Sweden), we
demonstrated the association of GSK-3 and cdk5 with
neurofibrillary degeneration at all Braak stages of this
pathology [98100].
that in AD brain the I2 PP2A is cleaved into amino terminal and carboxy terminal halves and is translocated
from neuronal nucleus to cytoplasm [126]. Both I PP2A
1
and IPP2A
interact with the catalytic subunit of PP2A
2
(Chen et al., in preparation). We discovered that the
level of IPP2A
is 20% greater in AD brains than in
1
age-matched control brains, which probably is a cause
of the decrease in PP-2A activity in AD brain.
9.3. Substrate regulation of the phosphorylation of tau
In addition to the activities of the tau kinases and
phosphatases, the phosphorylation of tau is also regulated by its conformational state. Free tau is more readily hyperphosphorylated than is microtubule-bound tau.
The rate and extent of tau phosphorylation by PKA,
CaM Kinase II, C-kinase, casein kinase (CK)-I, cdk5,
and GSK-3 are dependent on its initial phosphorylation state. For instance, we demonstrated that when
recombinant human brain tau is prephosphorylated by
one of several non-PDPKs, i.e., PKA, CaM Kinase II
or C-kinase, its subsequent phosphorylations catalyzed
by the PDPK cdk5 or GSK-3 are stimulated severalfold [117,119]. In addition, the rate and extent to which
various tau isoforms are phosphorylated also depend
on whether tau contains three or four repeats and zero,
one, or two N-terminal inserts [121].
We discovered that in addition to abnormal hyperphosphorylation, tau is also abnormally glycosylated,
and that in AD brain, the latter appears to precede the
former [86,87,141]. Furthermore, we found by in vitro
studies that the abnormal glycosylation promotes tau
phosphorylation with PKA, GSK-3, and ckd5 and inhibits dephosphorylation of tau with PP2A and PP5 [9,
87]. In addition, like some other neuronal phosphoproteins, tau is also O-GlcNAcylated [51]. In contrast
to classical N- or O-glycosylation, O-GlcNAcylation
which involves the addition of a single sugar at serine/threonine residues of a protein, dynamically posttranslationally modifies cytoplasmic and nuclear proteins in a manner analogous to protein phosphorylation (see [88]). In collaboration with Cheng-Xin Gong,
we discovered that O-GlcNAcylation and phosphorylation of tau reciprocally regulate each other, and that
decreased glucose metabolism in cultured cells and in
mice, which decreases the O-GlcNAcylation of tau,
produces abnormal hyperphosphorylation of this protein. Furthermore, we found that in AD, probably as a
result of impaired glucose uptake/metabolism, there is
a global decrease in O-GlcNAcylation.
233
234
Fig. 9. Immunostaining of Alzheimer (ae) and 38-year-old control (f and g) hippocampus with mAb to amyloid (a, b and dg) or anti-PHF
serum (c). (a) mAb to amyloid stains plaques (arrowhead) and intraneuronal material (arrows), which at low power looks like neurofibrillary
tangles. However, at high magnification (b), it presents a tightly packed granular material and can be easily distinguished from the tangles, which
are fibrillar when stained with anti-PHF serum (c) or thioflavine S (e). (d and e) Amyloid-immunoreactive material and thioflavine S-positive
fluorescent tangles frequently occur in the same neuron. (a, X 200; b and c, X 1000; d and e, X 420; f and g, x 280).
Reproduced with permission from Grundke-Iqbal et al., Proc. Natl. Acad. Sci. USA 86:28532857, 1989.
235
Fig. 10. A schematic showing different major steps of the Metabolic/signal transduction hypothesis. AD and other tauopathies require a genetic
predisposition. They are triggered by a variety of environmental factors affecting one or more specific signal transduction pathways, which
result in a protein phosphorylation/dephosphorylation imbalance and the abnormal hyperphosphorylation of tau. This leads to neurofibrillary
degeneration and dementia. In Ad, the protein phosphorylation/dephosphorylation imbalance in the affected neurons is generated at least in part
by a decrease in the activities of tau phosphatases, i.e., PP2A and PP1; the activities of tau kinases such as cdk5, GSK-3, CaM kinase II and
PKA might also be increased in the affected neurons. This protein phosphorylation/dephosphorylation imbalance probably involves an alteration
of a specific signal transduction pathway(s) produced by an increase in the levels of an extracellular signal, e.g., FGF2 or an alteration in the
molecular topology of the neuronal cell membrane or both. With age, the molecular topology of the ell membranes is altered due to a decrease
in membrane fluidity. The mutations in transmembrane proteins, such as -APP, PS1 and PS2, increase the vulnerability of the cell membrane
to alteration in pathological signal transduction. The increased risk for AD in the carriers of APOE4 allele as opposed to APOE2 or APOE3
alleles might also involve alteration of signal transduction through the interaction of APOE4 with the neuronal cell membrane. Any mutation
or post-translational modification of tau that will make it a better substrate for abnormal hyperphosphorylation will also increase the risk for the
disease. High cholesterol might be involved in decreasing membrane fluidity. Decreased glucose metabolism/uptake might lead to the abnormal
hyperphosphorylation of tau through a decrease in its O-GlcN-acylation.
Reproduced with permission from Iqbal and Grundke-Iqbal, Acta Neuropathol. (berl) 109:2531, 2005.
mon downstream deleterious functional effect the hyperphosphorylation of tau. Thus, therapeutic interventions that can overcome the deleterious effect/s of the
pathological tau appear promising.
236
The most promising therapeutic approaches to inhibit neurofibrillary degeneration and consequently AD
are (1) to inhibit sequestration of normal MAPs by the
AD P-tau and (2) to inhibit the abnormal hyperphosphorylation of tau. The latter can be carried out either
by restoring the PP-2A activity in the affected areas
of the brain to normal levels or by inhibiting the activity of one or more tau kinases that are critically involved in converting normal tau into an abnormal state
whereby it sequesters normal MAP. In collaboration
with Jian-Zhi Wang, we demonstrated that the activation of PKA with forskolin or isoproterenol primes tau
for abnormal hyperphosphorylation by the constitutive
GSK-3 activity in adult rats, and the spatial memory
of these animals is impaired [89,123]. Co-treatment of
these animals with forskolin and RP-cAMPS, a PKA
inhibitor, inhibited the abnormal hyperphosphorylation
of tau and the impairment of spatial memory. We discovered that memantine, a low- to moderate-affinity
NMDA receptor antagonist, which improves mental
function and the quality of daily living of patients with
moderate to severe AD [107,146], restores the okadaic
acid-induced inhibition of PP-2A activity, the abnormal
hyperphosphorylation of tau at Ser-262, and the associated neurodegeneration in hippocampal slice cultures
from adult rats [85]. Furthermore, the restoration of
the PP-2A activity to normal levels by memantine also
results in the restoration of the expression of MAP2 in
the neuropil and a reversal of the hyperphosphorylation and the accumulation of neurofilament H and M
subunits.
Inhibition of the abnormal hyperphosphorylation of
tau and sequestration of normal MAPs by the hyperphosphorylated tau are among the most promising therapeutic targets for AD and other tauopathies.
Approaches to inhibit the abnormal hyperphosphorylation of tau include the inhibition of the one
or more tau kinase activities, activation of one or
more tau phosphatases, and the enhancement of brain
glucose metabolism, which directly affects the OGlcNAcylation of tau.
the correlation of those brain lesions to clinical expression of the disease, i.e., the dementia, were available.
Our persistence in carrying out systematic studies on
neurodegeneration in AD led us to several key discoveries, which include (1) the isolation and protein composition of PH F [59,60]; (2) identification of tau and
its abnormally hyperphosphorylated state as the major
protein subunit of PHF [47,48]; (3) the presence of
the abnormally hyperphosphorylated tau in AD brain
cytosol and the inhibition of microtubule assembly by
the pathological tau [61]; (4) the decrease in the activities of PP-2A and PP-1 in AD brain as a cause of
the abnormal hyperphosphorylation of tau [35,37]; (5)
the sequestration of normal tau, MAP1, and MAP2 by
the abnormally hyperphosphorylatedtau as a molecular
mechanism of neurofibrillary degeneration [13]; (6)
the promotion of the self-assembly of tau into tangles
of PHF by its hyperphosphorylation [4]; and (7) the
intraneuronal localization of A [49].
During our more than 30 years of research work on
AD, we have had the fortune of collaborating with a
large number of senior scientists, and in our own research group with graduate students, postdoctoral fellows, and young scientists. We would like to acknowledge Robert D. Terry, at whose initiative and with
whose support we entered the AD field. Henry M.
Wisniewski carried out the morphological evaluation of
the PHF preparations for our first study and fought for
us during the PHF solubility controversy in the early
1980s. Sabiha Khatoons discovery of normal levels of
normal-like tau and of the several-fold increase in abnormally hyperphosphorylated tau in AD not only laid
the foundation of subsequent studies on the molecular
mechanisms of neurofibrillary degeneration, but also
stimulated research on studies on the CSF levels of tau
and phosphor-tau as a potential diagnostic biomarker.
Gian Ping Wang was the first to generate monoclonal
antibodies to PHF, and he and Takashi Kudo demonstrated the elevated level of conjugated ubiquitin in AD
CSF. Cheng-Xin Gongs discovery of the decrease in
PP-2A/PP-1 activities in AD brain identified a cause
of abnormal hyperphosphorylation of tau and demonstrated the involvement of these phosphatases in neurofibrillary degeneration. Alejandra del C. Alonso discovered the sequestration of normal tau, MAP1, and
MAP2 by the abnormally hyperphosphorylated tau as
a key likely step in the molecular mechanism of neurofibrillary degeneration and demonstrated that abnormal hyperphosphorylation alone is sufficient to cause
self-assembly of tau into tangles of PHF. Jian-Zhi Wang
found that neurofibrillary tangles/PHF could be dis-
sociated by PP-2A or PP-2B, releasing dephosphorylated tau, which was biologically active in promoting
microtubule assembly. She also discovered that, unlike normal brain tau, tau in PHF was glycosylated and
that the generation of AD-like abnormally hyperphosphorylated tau, which results in its self-assembly into
PHF, requires catalysis by cdk5 and GSK-3, or one
of these kinases along with PKA and CaMKII. Jin-Jing
Pei demonstrated the association of GSK-3 and cdk5
with neurofibrillary pathology from early Braak stages.
Toshihisa Tanaka generated the first cell culture model
of neurofibrillary pathology. Fei Liu discovered that OGlcNAcylation and phosphorylation of tau reciprocally
regulate each other and that, due to decreased brain glucose metabolism, there is most likely a global decrease
in O-GlcNAcylation in AD brain. Hitoshi Tanimukai
and Ichiro Tsujio discovered a decrease in the mRNAs
of PP-2A inhibitors and translocation of the N-terminal
half of the I2 of PP-2A from neuronal nucleus to the
cytoplasm in AD brains. Last but not least, our two research assistants, Tanweer Zaidi and Yunn Chyn Tung,
helped develop the technique for the bulk isolation and
solubilization of PHF, and the generation of antibodies
and the identification of tau as the major component of
PHF, respectively.
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
Acknowledgements
We thank Janet Biegelson and Sonia Warren for providing secretarial assistance, including the preparation
of this manuscript, and Maureen Marlow for copy editing. Currently, our studies on neurofibrillary degeneration are supported in part by the New York State Office
of Mental Retardation and Developmental Disabilities
and a National Institutes of Health/National Institute
on Aging grant AG19158.
[12]
[13]
[14]
[15]
References
[1]
[2]
[3]
[16]
[17]
[18]
237
238
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[74]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
239
K. Iqbal and I. Grundke-Iqbal, Metabolic/signal transduction hypothesis of Alzheimers disease and other tauopathies,
Acta Neuropathol. (Berl) 109 (2005), 2531.
K. Iqbal, A. del C. Alonso, M.O. Chohan, E. El-Akkad, C.X.
Gong, S. Khatoon, B. Li, F. Liu, A. Rahman, H. Tanimukai
and I. Grundke-Iqbal, Tau pathology in Alzheimer disease
and other tauopathies, Biochim. Biophys. Acta. 1739 (2005),
198210.
T. Ishii, S. Haga and S. Tobutake, Presence of neurofilament
protein in Alzheimers neurofibrillary tangles (ANF); an immunofluorescent study, Acta. Neuropathol. (Berl.) 48 (1979),
105112.
T. Kampers, P. Friedhoff, J. Biernat, E.M. Mandelkow and
E. Mandelkow, RNA stimulates aggregation of microtubuleassociated protein tau into Alzheimer-like paired helical filaments, FEBS Lett 399 (1996), 344349.
R. Katzman, R.D. Terry, R. DeTeresa, R. Brown, P. Davies,
P. Fuld, X. Renling and A. Peck, Clinical, pathological and
neurochemical changes in dementia a subgroup with preserved mental status and numerous neocortical plaques, Ann.
Neurol. 23 (1988), 138144.
S. Khatoon, I. Grundke-Iqbal and K. Iqbal, Brain levels of microtubule-associated protein tau are elevated in
Alzheimers disease brain: a radioimmunoslot-blot assay for
nanograms of the protein, J. Neurochem. 59 (1992), 750753.
S. Khatoon, I. Grundke-Iqbal and K. Iqbal, Levels of normal and abnormally phosphorylated tau in different cellular
and regional compartments of Alzheimer disease and control
brains, FEBS Lett 351 (1994), 8084.
S. Khatoon, I. Grundke-Iqbal and K. Iqbal, Guanosine
triphosphate binding to -subunit of tubulin in Alzheimers
disease brain Role of microtubule-associated protein , J.
Neurochem. 64 (1995), 777787.
M. Kidd, Paired helical filaments in electron microscopy of
Alzheimers disease, Nature 197 (1963), 192193.
M. Kidd, Alzheimers disease an electron microscopical
study, Brain 87 (1964), 307320.
K.S. Kim, D.L. Miller, C.M.J. Chen, V.J. Sapienza, C. Bai, I.
Grundke-Iqbal, J.R. Currie and H.M. Wisniewski, Production
and characterization of monoclonal antibodies reactive to
synthetic cerebrovascular amyloid peptide, Neurosci. Res.
Commun. 2 (1988), 121130.
E. K?pke, Y.C. Tung, S. Shaikh, A. del C. Alonso, K. Iqbal
and I. Grundke-Iqbal, Microbutule associated protein tau abnormal phosphorylation of a non-paired helical filament pool
in Alzheimer disease, J. Biol. Chem. 268 (1993), 24374
24384.
K. Kosik, L.K. Duffy, M.M. Dowling, C. Abraham, A. McCluskey and D. Selkoe, Microtubule-associated protein 2
monoclonal antibodies demonstrate the selective incorporation of certain epitopes into Alzheimer neurofibrillary tangles, Proc. Natl. Acad. Sci. USA 81 (1984), 79417945.
K.S. Kosik, C.L. Joachim and D.J. Selkoe, The microtubuleassociated protein, tau, is a major antigenic component of
paired helical filaments in Alzheimers disease, Proc. Natl.
Acad. Sci USA 83 (1986), 40444048.
H. Ksiezak-Reding, W.K. Liu and S.H. Yen, Phosphate analysis and dephosphorylation of modified tau associated with
paired helical filaments, Brain Res 597 (1992), 209219.
G. Lee, N. Cowan and M. Kirschner, The primary structure
and heterogeneity of tau protein from mouse brain, Science
239 (1988), 285288.
E. Levy, M.D. Carman, I.J. Fernandez-Madrid, M.D. Power,
I. Lieberburg, S.G. van Duinen, G.T. Bots, W. Luyendijk and
240
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]
[102]
[103]
[104]
[105]
[106]
[107]
[108]
[109]
[110]
[111]
[112]
synthase kinase-3 in the Alzheimer Disease brain, J. Neuropathol. Exp. Neurol. 56 (1997), 7078.
J.J. Pei, I. Grundke-Iqbal, K. Iqbal, N. Bogdanovic, B. Winblad and R. Cowburn, Accumulation of cyclin-dependent
kinase-5 (cdk5) in neurons with early stages of Alzheimers
disease neurofibrillary degeneration, Brain Res 797 (1998),
267277.
J.J. Pei, E. Braak, H. Braak, I. Grundke-Iqbal, K. Iqbal, B.
Winblad and R.F. Cowburn, Distribution of active Glycogen Synthase Kinase 3 (GSK-3) in brains staged for
Alzheimers disease neurofibrillary changes, J. Neuropathol.
Exper. Neurol. 58 (1999), 10101019.
J.J. Pei, C.X. Gong, W.L. An, B. Winblad, R.F. Cowburn,
I. Grundke-Iqbal and K. Iqbal, Okadaic-Acid-Induced inhibition of protein phosphatase 2A produces activation of
mitogen-activated protein kinases ERK1/2, MEK1/2, and
p70 S6, similar to that in Alzheimers disease, Am. J. Pathol.
163 (2003), 845858.
M. Perez, J.M. Valpuesta, M. Medina, E. Montejo de Garcini
and J. Avila, Polymerization of tau into filaments in the presence of heparin the minimal sequence required for tau-tau
interaction, J. Neurochem. 67 (1996), 11831190.
G. Perry, N. Rizzuto, L. Autilio-Gambetti and P. Gambetti, Alzheimers paired helical filaments contain cytoskeletal components, Proc. Natl. Acad. Sci. USA 82 (1985), 3916
3920.
P. Poorkaj, T.D. Bird, E. Wijsman, E. Nemens, R.M. Garruto,
L. Anderson, A. Andreadis, W.C. Wiederholt, M. Raskind
and G.D. Schellenberg, Tau is a candidate gene for chromosome 17 frontotemporal dementia, Ann. Neurol. 43 (1998),
815825.
A.
Rahman, I. Grundke-Iqbal and K. Iqbal, Phosphothreonine212 of Alzheimer abnormally hyperphosphorylated tau is a
preferred substrate of protein phosphatase-1, J. Neurochem.
Res. 30 (2005), 277287.
A. Rahman, I. Grundke-Iqbal and K. Iqbal, PP2B isolated
from human brain preferentially dephosphorylates Ser-262
and Ser-396 of the Alzheimer Disease abnormally hyperphosphorylated tau, J. Neural. Transm. (2005), (Epub ahead
of print).
B. Reisberg, R. Doody, A. SToffler, F. Schmitt, S. Ferris and
H.J. Mobius, Memantine in moderate-to-severe Alzheimers
disease, N. Engl. J. Med. 348 (2003), 13331341.
G.W. Roberts, T.J. Crow and J.M. Polak, Location of neuronal tangles in somatostatin neurones in Alzheimers disease, Nature 314 (1985), 9294.
R. Rubenstein, R. J. Kascsak, P.A. Merz, H.M. Wisniewski,
R.I. Carp and K. Iqbal, Paired helical filaments associated
with Alzheimer disease are readily soluble structures, Brain
Res 372 (1986), 8088.
K. SantaCruz, J. Lewis, T. Spires, J. Paulson, L. Kotilinek,
M. Ingelsson, A. Guimaraes, M. DeTure, M. Ramsden, E.
McGowan, C. Forster, M. Yue, J. Orne, C. Janus, A. Mariash,
M. Kuskowski, B. Hyman, M. Hutton and K.H. Ashe, Tau
suppression in a neurodegenerative mouse model improves
memory function, Science 308 (2005), 476481.
Y. Sato, Y. Naito, I. Grundke-Iqbal, K. Iqbal and T. Endo,
Analysis of N-glycans of pathological tau possible occurrence of aberrant processing of tau in Alzheimers disease,
FEBS Lett 496 (2001), 152160.
O. Schweers, E.M. Mandelkow, J. Biernat and E. Mandelkow, Oxidation of cysteine-322 in the repeat domain of
microtubule-associated protein controls the in vitro assem-
[113]
[114]
[115]
[116]
[117]
[118]
[119]
[120]
[121]
[122]
[123]
[124]
[125]
[126]
[127]
[128]
[129]
[130]
[131]
[132]
[133]
[134]
[135]
[136]
[137]
[138]
[139]
[140]
[141]
[142]
[143]
[144]
241
242
[145]
D.M. Wilson and L.I. Binder, Polymerization of microtubuleassociated protein tau under near-physiological conditions,
J. Biol. Chem. 270 (1995), 2430624314.
[146] B. Winblad and N. Poritis, Memantine in severe dementia:
results of the 9M-Best Study (Benefit and efficacy in severely
demented patients during treatment with memantine), Int. J.
Geriatr. Psychiatry 14 (1999), 135146.
[147] C.W. Wong, V. Ouaranta and G.G. Glenner, Neuritic plaques
and cerebrovascular amyloid in Alzheimer disease are antigenically related, Proc. Natl. Acad. Sci. USA 82 (1985),
87298732.
[148] J.G. Wood, S.S. Mirra, N.J. Pollock and L.I. Binder, Neurofibrillary tangles of Alzheimer disease share antigenic
243
Corresponding author: Gail V.W. Johnson, Ph.D., Professor, Department of Psychiatry, 1720 7th Avenue South, SC1061, University
of Alabama at Birmingham, School of Medicine, Birmingham, AL
35294-0017, USA. Tel.: +1 205 934 2465; Fax: +1 205 934 2500;
E-mail: gvwj@uab.edu.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
244
Fig. 2. Quantitative analysis of the calpain-induced (1:20, enzyme-to-substrate ratio) proteolysis of control tau (open circle), tau
phosphorylated by PKA (closed circle), or tau dephosphorylated by
alkaline phosphatase (open triangle). Reprinted from [25] with permission from the publisher.
245
Fig. 3. Autoradiographs of two-dimensional phosphopeptide mapping of tau resulting from basal phosphorylation in situ (a), rolipram (a
phosphodiesterase inhibitor) and forskolin (an activator of adenylyl cyclase) stimulated phosphorylation (b), tau phosphorylated in vitro by PKA
(c), or a combination of (b) and (c) (d). Slices were treated as indicated, and tau was excised from polyacrylamide gels, digested with proteases
and subjected to electrophoresis on cellulose TLC plates, followed by ascending chromatography. Peptides phosphorylated in situ are indicated
by numbers (a, b and d) and peptides phosphorylated in vitro by letters (c and d). Reproduced with permission from Fleming and Johnson (1995),
c
Biochemical Journal 309, 4147. The
Biochemical Society.
246
Fig. 4. Asp421 truncated tau constructs are not phosphorylated by GSK3 as efficiently as full-length tau constructs. A. and B. Cells were
transiently transfected with T4L (Tau + exons 2,3 and 10), T4L-D421 (T4-D), T4 (Tau exons 2 and 3, + exon 10), or T4-D421 (T4-D)
alone, or in combination with glycogen synthase kinase 3 (GSK3) (The D421 constructs were truncated at Asp421 to mimic caspase-cleaved
tau). The expression level of all tau constructs was similar and GSK3 expression levels were also the same in all the transiently transfected
cells. Representative immunoblots with Tau5/5A6 (Total tau) showed that overexpression of GSK3 reduced the electrophoretic mobility of
T4L and T4 compared with the mobility observed in the absence of GSK3. A. Phosphorylation of full-length tau (T4L or T4) by GSK3
resulted in a robust increase in PHF-1 (Ser396/404) and AT180 (Thr231) immunoreactivity compared to that when tau was expressed alone. In
contrast, co-expression of GSK3 with the Asp421 truncated tau constructs (T4L-D4 or T4-D) resulted in minimal increases in PHF1 and AT180
immunoreactivity. The actin blots demonstrate that equal amounts of protein were loaded in each lane. B. Expression of GSK3 also resulted in a
robust increase in the phosphorylation of full-length tau (T4L or T4), but not the Asp421 truncated tau constructs (T4L-D4 or T4-D), at the Tau-1
epitope (Tau-1 recognizes a dephosphorylated epitope so decreased immunoreactivity indicates increased phosphorylation), Thr205 and Ser199.
12E8 immunoreactivity was the same for all constructs in the absence () or presence (+) of GSK3. The actin blots shows that same amount of
protein was loaded in each lane. C. Representative autoradiograph (of 4 separate experiments) showing the phosphorylation of recombinant T4L
and T4L-D421 by recombinant GSK3 in an in vitro kinase assay. The tau constructs were incubated with GSK3 for the times indicated. The
data show that T4L is phosphorylated by GSK3 much more efficiently than T4L-D421. Reprinted from [4] with permission from the publisher.
247
Fig. 5. Tau and Tau phosphorylated by glycogen synthase kinase 3 (GSK3) are cleaved by active caspase-3 at the same rate and to the same
extent. Lysates from cells transfected with either T4L (Tau + exons 2,3 and 10) alone or T4L and GSK3( (T4L/GSK3) were incubated with
active caspase-3 for the times indicated and subsequently immunoblotted for total tau levels with Tau5/5A6. These data demonstrate that T4L
and phosphorylated T4L are equivalent substrates of caspase-3. Reprinted from [4] with permission from the publisher.
248
Fig. 6. The Asp421 truncated tau constructs become sarkosyl insoluble in the presence of glycogen synthase kinase 3 (GSK3).
A. Cells were transiently transfected with tau constructs alone or
with GSK3. Cell lysates were then fractionated into soluble,
sarkosyl soluble and sarkosyl insoluble fractions. The expression
of the tau constructs was equivalent for all conditions (Total tau).
Co-expression of GSK3 resulted in both T4L-D421 (T4L-D) and
T4-D421 (T4-D) partitioning into the sarkosyl insoluble fraction.
Even in the presence of GSK3, the full-length tau constructs were
never observed in the sarkosyl insoluble fraction. B. The sarkosyl-insoluble fractions from cells transfected with GSK3 and either
T4L or T4L-D421 were probed with the phospho-tau independent tau
antibodies Tau5/5A6 or the phospho-dependent antibodies, PHF1,
phospho-Ser199, 12E8 or phospho-Thr231. These results show that
the T4L-D421 in the sarkosyl insoluble fractions is phosphorylated
at the PHF1 and Ser199 epitopes. The top panel (input) shows that
the amount of tau in the samples was equivalent prior to the preparation of the sarkosyl insoluble fractions. Reprinted from [4] with
permission from the publisher.
5. Summary
There is now significant evidence that tau is an in
vivo substrate of calpain, as well as caspases and the
proteasome. Further, site-specific phosphorylation of
tau regulates its susceptibility to calpain-mediated proteolysis, however whether or not hyperphosphorylation
of specific sites on tau in Alzheimers disease brain
make it more resistant to calpain hydrolysis and thus
contribute to the tau pathogenic cascade remains to be
determined. It is also presently unclear how phosphorylation impacts tau proteolysis by the caspases or the
proteasome, and how dysregulation of these proteolytic
systems in Alzheimers disease may facilitate the formation of tau pathology. Nonetheless, in the years since
our initial discovery that tau is a substrate of calpain
and that phosphorylation by PKA inhibits tau proteol-
[12]
[13]
Acknowledgements
[14]
References
N. Canu, L. Dus, C. Barbato, M.T. Ciotti, C. Brancolini, A.M.
Rinaldi, M. Novak, A. Cattaneo, A. Bradbury and P. Calissano,
Tau cleavage and dephosphorylation in cerebellar granule neurons undergoing apoptosis, J Neurosci 18 (1998), 70617074.
[2] C. Cardozo and C. Michaud, Proteasome-mediated degradation of tau proteins occurs independently of the chymotrypsinlike activity by a nonprocessive pathway, Arch Biochem Biophys 408 (2002), 103110.
[3] M. Chen and A. Stracher, In situ phosphorylation of platelet
actin-binding protein by cAMP-dependent protein kinase stabilizes it against proteolysis by calpain, J Biol Chem 264
(1989), 1428214289.
[4] J.H. Cho and G.V. Johnson, Primed phosphorylation of tau at
Thr231 by glycogen synthase kinase 3beta (GSK3beta) plays
a critical role in regulating taus ability to bind and stabilize
microtubules, J Neurochem 88 (2004), 349358.
[5] D.W. Cleveland, S.Y. Hwo and M.W. Kirschner, Physical and
chemical properties of purified tau factor and the role of tau in
microtubule assembly, J Mol Biol 116 (1977), 227247.
[6] D.C. David, R. Layfield, L. Serpell, Y. Narain, M. Goedert
and M.G. Spillantini, Proteasomal degradation of tau protein,
J Neurochem 83 (2002), 176185.
[7] P. Delobel, O. Leroy, M. Hamdane, A.V. Sambo, A. Delacourte
and L. Buee, Proteasome inhibition and Tau proteolysis: an
unexpected regulation, FEBS Lett 579 (2005), 15.
[8] F. Dou, W.J. Netzer, K. Tanemura, F. Li, F.U. Hartl, A.
Takashima, G.K. Gouras, P. Greengard and H. Xu, Chaperones
increase association of tau protein with microtubules, Proc
Natl Acad Sci USA 100 (2003), 721726.
[9] L.M. Fleming and G.V. Johnson, Modulation of the phosphorylation state of tau in situ: the roles of calcium and cyclic
AMP, Biochem J 309(Pt 1) (1995), 4147.
[10] T.C. Gamblin, F. Chen, A. Zambrano, A. Abraha, S. Lagalwar,
A.L. Guillozet, M. Lu, Y. Fu, F. Garcia-Sierra, N. LaPointe,
R. Miller, R.W. Berry, L.I. Binder and V.L. Cryns, Caspase
cleavage of tau: linking amyloid and neurofibrillary tangles
in Alzheimers disease, Proc Natl Acad Sci USA 100 (2003),
1003210037.
[11] B.I. Giasson, M.S. Forman, M. Higuchi, L.I. Golbe, C.L.
Graves, P.T. Kotzbauer, J.Q. Trojanowski and V.M. Lee, Initiation and synergistic fibrillization of tau and alpha-synuclein,
Science 300 (2003), 636640.
[15]
[16]
[1]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
249
250
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
251
all of the interest in Alzheimer neuropathology centered on the neurofibrillary tangle, the structure which
Alois Alzheimer had focused upon.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
252
Alzheimer brain tissue, we were surprised by the extensive neuritic changes [33,38]. Previously the pathology was believed to be confined to the more limited
number of tangles observed within cell bodies or as
vestiges of dead cells called ghost tangles or tombstones. The antibodies dramatically revealed that the
pathology extended to the neuronal processes, which
appeared as swollen dystrophic neurites that often completely dominated the principle anatomical target areas
of the Alzheimer brain. Not surprisingly these early descriptions of neuritic pathology, referred to as neuropil
threads or curly fibers, foreshadowed another aspect of
the pathology-the loss of synapses [13].
253
and through links to anti-apoptotic pathways the neuron musters many mechanisms to salvage itself in the
face of a precipitant which seems to trigger tangle formation.
254
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
255
A. Caceres, J. Mautino and K.S. Kosik, Suppression of MAP2 in cultured cerebellar macroneurons inhibits minor neurite
formation, Neuron 9 (1992), 607618.
D. Cleveland, S. Hwo and M. Kirschner, Purification of tau, a
microtubule-associated protein that induces assembly of microtubules from purified tubulin, J. Mol. Biol 116 (1977), 207
225.
D. Cleveland, S. Hwo and M. Kirschner, Physical and chemical properties of purified tau factor and the role of tau in
microtubule assembly, J. Mol. Biol 116 (1977), 227247.
C.C. Cunningham, N. Leclerc, L. Flanagan, M. Lu, P.A. Janmey and K.S. Kosik, MAP2c reorganizes both microtubules
and microfilaments into distinct cytological structures in an
ABP-280 deficient melanoma cell line, J. Cell Biol. (1997),
(in press).
S.T. DeKosky and S.W. Scheff, Synapse loss in frontal cortex
biopsies in Alzheimers disease: Correlation with cognitive
severity, Ann. Neurol. 27 (1990), 457464.
M.C. DiTella, F. Feiguin, N. Carri, K.S. Kosik and A. Caceres,
MAP-1B/tau functional redundancy during laminin-enhanced
axonal growth, J. Cell Sci. 109 (1996), 467477.
M.I. Escobar, H. Pimienta, V.S. Caviness, M. Jacobson, J.E.
Crandall and K.S. Kosik, Architecture of apical dendrites in
the murine neocortex: dual apical dendritic systems, Neuroscience 17 (1986), 975989.
P.G. Galloway, G. Perry, K.S. Kosik and P. Gambetti, Hirano
bodies contain tau protein, Brain Res 430 (1987), 337340.
I. Grundke-Iqbal, K. Iqbal, M. Quinlan, Y.-C. Tung, M.S.
Zaidi and H.M. Wisniewski, Microtubule-associated protein
tau: a component of Alzheimer paired helical filaments, J.
biol. Chem 261 (1986), 60846089.
I. Grundke-Iqbal, K. Iqbal, Y.-C. Tung, M. Quinlan, H.M.
Wisniewski and L.I. Binder, Abnormal phosphorylation of the
microtubule-associated protein t (tau) in Alzheimer cytoskeletal pathology, Proc. Natl. Acad. Sci. USA 83 (1986), 4913
4917.
C. Joachim, J. Morris, D. Selkoe and K. Kosik, Tau epitopes
are incorporated into a range of lesions in Alzheimers disease,
J Neuropath Exp Neurol 46 (1987), 611622.
C.L. Joachim, J.H. Morris, K.S. Kosik and D.J. Selkoe, Tau
antisera recognize neurofibrillary tangles in a range of neurodegenerative disorders, Ann Neurol 22 (1987), 514520.
J. Knops, K. Kosik, G. Lee, J. Pardee, L. Cohen-Gould and
L. McConlogue, Overexpression of tau in a nonneuronal cell
induces long cellular processes, J. Cell Biol 114 (1991), 725
733.
R. Knowles, N. LeClerc and K.S. Kosik, Organization of actin
and microtubules during process formation in tau-expressing
Sf9 cells, Cell Motil Cytoskeleton 28 (1994), 256264.
J. Kondo, T. Honda, H. Mori, Y. Hamada, R. Miura, M.
Ogawara and Y. Ihara, The carboxyl third of tau is tightly
bound to paired helical filaments, Neuron 1 (1988), 827834.
K. Kosik, J. Crandall, E. Mufson and R. Neve, in situ hybridization in normal and Alzheimer brain: Localization in the
somatodendritic compartment, Ann. Neurol 26 (1989), 352
361.
K. Kosik, L. Orecchio, S. Bakalis and R. Neve, Developmentally regulated expression of specific tau sequences, Neuron 2
(1989), 13891397.
K.S. Kosik, J.M. Gilbert, D.J. Selkoe and P. Strocchi, Characterization of postmortem human brain proteins by twodimensional gel electrophoresis, J. Neurochem. 39 (1982),
15291538.
256
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
257
1. Introduction
Corresponding
Alzheimers disease (AD) and a number of other neurodegenerative disorders now are known to result from
the aggregation of proteins that misfold and accumulate
as fibrillar amyloid deposits in selectively vulnerable
regions of the central nervous system (CNS) where they
are thought to compromise the function and viability
of neurons and glia (for a recent review, see [5]). For
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
258
V.M.-Y. Lee and J.Q. Trojanowski / Progress from Alzheimers tangles to pathological tau points
example, abnormal tau filaments accumulate in neurons as neurofibrillary tangles (NFTs) while extracellular senile plaques (SPs) are composed of fibrillar A
and both were first recognized by Alois Alzheimer at
the beginning of the 20th Century as the diagnostic
hallmark lesions of AD [5]. Although the discovery
of pathogenic mutations in the genes encoding tau and
the A precursor protein in familial neurodegenerative
disorders definitively implicated these proteins in disease pathogenesis, the mechanisms whereby brain degeneration results from NFTs and SPs still is not entirely clear [5]. Since this special issue of the Journal of
Alzheimers Disease celebrates the centennial of Alois
Alzheimers seminal description of AD by featuring reviews of the most significant advances in AD research
over the past 100 years, and the role of altered axonal
transport in neurodegenerative diseases also has been
reviewed recently [16], we provide a personal perspective here of our hypothesis that the impaired ability of
pathologically altered tau to bind microtubules (MTs)
in AD disrupts axonal transport leading to neurodegeneration (see Fig. 1). Based on predictions derived from
this hypothesis and extensive data supporting it, we
then discuss why MT binding drugs may be candidates
for the treatment of AD and other related neurodegenerative disorders by offsetting the loss of tau function
and maintaining axonal transport in the disease state.
To begin at the beginning for us, we embarked on
studies of AD in the 1980s during the heady and tumultuous early days of AD research on the molecular
basis of this enigmatic disorder when the field was in
the throes of a heated and highly disputatious controversy that raged over the role of tau in the formation of
paired helical filaments (PHFs) and NFTs in AD (for an
extensive review of the earlier literature on AD PHFs
and NFTs, see [11]). We vividly recall this time as a
most exciting but very raucous epoch of AD research
when each new molecular advance was welcomed with
an exhilarating sense of awe that AD really could be
cracked, but the rush of wonder and amazement at
each new finding by no means diminished the intensity of the contentious debates about the significance
and importance of many of these early molecular advances. Indeed, although several reports in the late
1980s had already implicated tau as the major building
block of PHFs (reviewed in [11]), this view was hotly
disputed and other potential subunit proteins were passionately proposed as candidate PHF building blocks
since there was no direct or iron clad evidence that
the structural components of PHFs (referred to as A68
at the time) were in fact pathologically altered forms
V.M.-Y. Lee and J.Q. Trojanowski / Progress from Alzheimers tangles to pathological tau points
259
Fig. 1. The misfolding, fibrillization and sequestration of tau into filamentous inclusions is schematically depicted here and, as described in
greater detail in the text, this compromises the survival of neurons by depleting levels of functional tau below a critical point which results in the
depolymerization of MTs and disruption of axonal transport. The brown arrows and text indicate points of potential therapeutic intervention to
ameliorate or reverse tau pathologies and their attendant neurodegenerative consequences.
260
V.M.-Y. Lee and J.Q. Trojanowski / Progress from Alzheimers tangles to pathological tau points
Studies we recently reported were specifically designed to test our hypothesis that MT stabilizing drugs
could have therapeutic benefit in AD and related human
tauopathies by offsetting the loss of normal tau functions resulting from the hyperphosphorylation of tau
and its sequestration into tangles [19]. Significantly,
these studies provided the first proof of concept data
validating the use of MT stabilizing drugs to treat AD
and related tauopathies. Briefly, transgenic (Tg) mice
(PrPT44) that model the neuropathology of human neurodegenerative tauopathies were treated with weekly
intraperitoneal injections of paclitaxel in a micelle vehicle (PaxceedTM ; Angiotech Pharmaceuticals, Inc.)
or the micelle vehicle alone for 12 weeks beginning at
9 months of age when disease onset is first detected.
Previous studies of these Tg mice showed that they
developed filamentous tau inclusions in spinal cord at
disease onset in association with reduced numbers of
MTs, reduced fast axonal transport, and impaired motor
behavior [8]. However, treatment with Paxceed TM restored fast axonal transport, increased axonal MTs and
ameliorated motor impairments in tau Tg mice thereby
suggesting that MT stabilizing drugs could have therapeutic benefit for human tauopathies. Notably, the
doses of paclitaxel used in the Zhang et al. study were
far lower than those used to treat cancer, and the treated
mice did not show any evidence of toxicity [19].
Paclitaxel (Taxol ) is a complex diterpene obtained
from the Pacific yew (Taxus brevifolia), especially from
the bark of the yew tree, and paclitaxel is the most well
studied MT binding compound for clinical use (for a review of MT binding drugs, see [18]). Indeed, paclitaxel
was the first compound derived from a natural product
that was shown to stabilize MTs and inhibit cell replication, and it has become an important chemotherapeutic agent for the treatment of cancer based on its ability to arrest mitosis by stabilizing MTs in the mitotic
spindle thereby leading to apoptosis [18]. For example,
Taxol has been approved by the FDA for the treatment of a number of malignancies including ovarian,
breast and lung cancers. However, the mechanism of
action of paclitaxel and its cytotoxic action for cancer
chemotherapy are shared by a growing number of natural products derived from microorganisms, plants and
sponges [18]. For this reason, extensive research is being conducted to identify synthetic and/or natural product derived paclitaxel-like MT binding compounds that
show less toxicity than paclitaxel, an improved ability
to enter the brain as well as elude the multi-drug resistance efflux pump and better efficacy as anti-cancer
therapies [18]. Thus, by providing convincing exper-
V.M.-Y. Lee and J.Q. Trojanowski / Progress from Alzheimers tangles to pathological tau points
imental evidence supporting the concept that MT stabilizing drugs could be novel therapeutic interventions
in patients with AD or other tauopathies by counteracting the loss of function effects of tau pathology and
maintaining the MT network and fast axonal transport
in a mouse model of a neurodegenerative tauopathy,
the study summarized above by Zhang et al. is likely to
stimulate further research on the potential therapeutic
utility of MT binding drugs for treating AD [19]. However, other strategies to develop novel therapies that
target tau abnormalities in AD already are an increasing focus of AD drug discovery research [4]. Although
further studies of the pharmacobiology of MT stabilizing drugs in the CNS are needed, the data summarized
here are significant for designing treatments for AD
and other neurodegenerative tauopathies because they
suggest that stabilization of MTs is a druggable target
in tauopathies. Further, follow up studies may reveal
that toxicity can be minimized further while producing therapeutic benefits by using lower, less frequent
doses of MT stabilizing compounds over long periods
of time. Moreover, recent studies by Michaelis and
colleagues indicate that derivatives of paclitaxel can be
generated that cross the blood brain barrier better than
the native molecule, while other in vitro studies suggest that Taxol may ameliorate the toxic effects of A
amyloidosis in AD [13,15].
In conclusion, based on the data reviewed in this personal perspective on AD research on NFTs and PHFtau, we infer that it is plausible MT stabilizing drugs
such as PaxceedTM may be novel candidate compounds
worthy of further investigation for therapeutic potential in the treatment of patients with neurodegenerative tauopathies, including AD. Indeed, MT stabilization may be required to complement other emerging
AD therapies that target other mechanisms of neurodegeneration. Accordingly, the extensive progress in elucidating the role of tau pathologies in mechanisms of
neurodegeneration in AD and related tauopathies since
the initial discovery of NFTs by Alois Alzheimer 100
years ago has created a sense of optimism that these
recent advances will culminate in the discovery of more
effective therapies for these disorders in the near future. Thus, while AD research seems less convulsed
now than in previous decades by strident controversies
and stormy debates, the sense of optimism about discovering more effective therapies for AD certainly infuses this field of neuroscience research with the kind
of excitement that has been its trademark since the days
of Alois Alzheimer.
261
Acknowledgments
We thank our colleagues for their contributions to the
work summarized here which has been supported by
grants from the NIH (AG10124, AG14382, AG17586),
the Oxford Foundation, the Marian S. Ware Alzheimer
Program and Angiotech Pharmaceuticals, Inc. MT stabilizing interventions for AD have been licensed to Angiotech from the University of Pennsylvania. VMYL is
the John H. Ware 3rd Professor for Alzheimers Disease
Research and JQT is the William Maul Measy-Truman
G. Schnabel Jr. M.D. Professor of Geriatric Medicine
and Gerontology.
References
[1]
G.T. Bramblett, M. Goedert, R. Jakes, S.E. Merrick, J.Q. Trojanowski and V.M.-Y. Lee, Abnormal tau phosphorylation at
Ser396 in Alzheimers disease recapitulates development and
contributes to reduced microtubule binding, Neuron 10 (1993),
10891099.
[2] G.T. Bramblett, J.Q. Trojanowski and V.M.-Y. Lee, Regions
with abundant neurofibrillary pathology in human brain exhibit a selective reduction in levels of binding-competent tau
and the accumulation of abnormal tau-isoforms (A68 proteins), Lab Invest 66 (1992), 212222.
[3] L.N. Clark, P. Poorkaj, Z. Wszolek, D.H. Geschwind, Z.Z.
Nasreddine, B. Miller, D. Li, H. Payami, F. Awert, K.
Markopoulou, A. Andreadis, I. DSouza, V.M.-Y. Lee, L.
Reed, J.Q. Trojanowski, V. Zhukareva, T. Bird, G. Schellenberg and K.C. Wilhelmsen, Pathogenic implications of mutations in the tau gene in pallido-ponto-nigral degeneration and
related neurogenerative disorders linked to chromosome 17,
Proc Natl Acad Sci USA 95 (1998), 1310313107.
[4] H.M. Fillit and L.M. Refolo, eds, Neurofibrillary Tangles as
a Target for Developng New Therapeutics for Alzheimers
Disease Special Issue, J Molec Neurosci 19(Issue 3) (2002),
251338.
[5] M.S. Forman, J.Q. Trojanowski and V.M.-Y. Lee, Neurodegenerative diseases: A decade of discoveries paves the way for
therapeutic breakthroughs, Nat Med 10 (2004), 10551063.
[6] M. Hong, V. Zhukareva, V. Vogelsberg-Ragaglia, Z. Wszolek,
L. Reed, B.I. Miller, D.H. Geschwind, T.D. Bird, D. McKeel, A. Goate, J.C. Morris, K.C. Wilhelmsen, G.D. Schellenberg, J.Q. Trojanowski and V.M.-Y. Lee, Mutation-specific
functional impairments in distinct tau isoforms of hereditary
FTDP-17, Science 282 (1998), 19141917.
[7] M. Hutton, C.L. Lendon, P. Rizzu, M. Baker, S. Froelich, H.
Houlden, S. Pickering-Brown, S. Chakraverty, A. Isaacs, A.
Grover, J. Hackett, J. Adamson, S. Lincoln, D. Dickson, P.
Davies, R.C. Petersen, M. Stevens, E. de Graaff, E. Wauters, J.
van Baren, M. Hillebrand, M. Joosse, J.M. Kwon, P. Nowotny,
L.K. Che, J. Norton, J.C. Morris, L.A. Reed, J.Q. Trojanowski,
H. Basun, L. Lannfelt, M. Neystat, S. Fahn, F. Dark, T. Tannenberg, P. Dodd, N. Hayward, J.B.J. Kwok, P.R. Schofield,
A. Andreadis, J. Snowden, D. Craufurd, D. Neary, F. Owen,
B.A. Oostra, J. Hardy, A. Goate, J. van Swieten, D. Mann, T.
Lynch and P. Heutink, Association of missense and 5-splicesite-mutations in tau with the inherited dementia FTDP-17,
Nature 393 (1998), 702705.
262
[8]
[9]
[10]
[11]
[12]
[13]
[14]
V.M.-Y. Lee and J.Q. Trojanowski / Progress from Alzheimers tangles to pathological tau points
T. Ishihara, M. Hong, B. Zhang, Y. Nakagawa, M.K. Lee, J.Q.
Trojanowski and V.M.-Y. Lee, Age-dependent emergence and
progression of a tauopathy in transgenic mice engineered to
overexpress the shortest human tau isoform, Neuron 24 (1999),
751762.
V.M.-Y. Lee, B.J. Balin, L. Otvos Jr. and J.Q. Trojanowski,
A68: A major subunit of paired helical filaments and derivatized forms of normal tau, Science 251 (1991), 675678.
V.M.-Y. Lee, R. Daughenbaugh and J.Q. Trojanowski, Microtubule stabilizing drugs for the treatment of Alzheimers
disease, Neurobiol Aging 15 (1994), S87S89.
V.M.-Y. Lee, M. Goedert and J.Q. Trojanowski, Neurodegenerative tauopathies, Annu Rev Neurosci 24 (2001), 11211159.
V.M.-Y. Lee, T.K. Kenyon and J.Q. Trojanowski, Transgenic
animal models of tauopathies, Biochem Biophys Acta 1739
(2005), 251259.
M.L. Michaelis, S. Ansar, Y. Chen, E.R. Reiff, K.I. Seyb,
R.H. Himes, K.L. Audus and G.I. Georg, Beta-amyloid- induced neurodegeneration and protection by structurally diverse microtubule-stabilizing agents, J Pharmacol Exp Ther
312 (2005), 659668.
P. Poorkaj, T.D. Bird, E. Wijsman, E. Nemens, R.M. Garruto,
L. Anderson, A. Andreadis, W.C. Wiederholt, M. Raskind and
G.D. Schellenberg, Tau is a candidate gene for chromosome
17 frontotemporal dementia, Ann Neurol 43 (1998), 815825.
[15]
[16]
[17]
[18]
[19]
Disease Mechanisms
265
1. Anniversaries
2006 is a significant anniversary year for me too. It
marks the 30th anniversary of my first publication in
the area of Alzheimers disease [1], the 20th anniversary of our first paper using monoclonal antibodies to
investigate the disease [2], and the 10th anniversary of
our first publication on mitotic mechanisms [3]. For
me, these mark milestones on my own path of research.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
266
P. Davies / A long trek down the pathways of cell death in Alzheimers disease
P. Davies / A long trek down the pathways of cell death in Alzheimers disease
human brain tissues [32], and a variety of mouse models have been created in part to try to address the issue
of mechanism of cell death. The major problem with
the models that involve amyloid deposition (transgenics with mutant human APP genes, for the most part)
is that there is little cell death to investigate. For several
years this has forced investigators to stay with the human brain to investigate mechanisms of cell death. We
have focused on trying to establish what mechanisms
might give rise to both abnormalities in tau conformation and phosphorylation, and to amyloid- deposition.
This vision sees the tangles and amyloid deposits as
the results of activation of a biochemical cascade, and
seeks the pathways that lead to both tau changes and
alterations in APP processing. There has been some
progress in this area, and plausible schemes involving
both JNK and Pin1 have been investigated. One of the
most influential papers in this area was the discovery
by Herrup and colleagues that vulnerable neurons in
the AD brain not only show activation of cell cycle
markers, but at least in some cases, show evidence of
DNA replication (S-phase) [33,34]. While it is possible to argue that some dysregulation of cell cycle proteins in neurons may be of little significance, it is very
hard to dismiss evidence that strongly suggests that
neurons in the AD brain duplicate a substantial proportion of their DNA: can these neurons continue normal
function and survive under these circumstances? This
seems highly unlikely. The mitotic hypothesis has
also received support from the recent demonstration
that hypoxia/ischemia in the mouse and rat brain may
also result in activation of the cell cycle, aberrant tau
phosphorylation and DNA replication prior to neuronal
death [35,36].
Human tau transgenic mice appeared to offer an opportunity to unravel mechanisms of cell death, especially after it was shown that some human tau gene
mutations cause massive cell death. A significant fraction of Frontotemporal dementia cases are caused by
mutations in the tau gene, cases so named because of
the obvious and massive neuronal death in frontal and
temporal cortex. Curiously, many of these cases do not
have the same substantial tau pathology that characterizes AD, but show even more neuronal loss in affected
regions than the average AD case. This is perhaps a
hint that tau-mediated cell death does not necessarily
involve tangle formation, as many seem to have assumed. Lewis et al made the first human tau transgenic
to unequivocally show neurofibrillary tangle formation,
using a human tau cDNA containing the P301L mutation [37]. Since that work was published, several other
267
5. But why?
Despite our meandering path, we seem to have
made progress towards understanding why cells die in
Alzheimers disease. But I sometimes feel like a threeyear old child, who asks a question, and responds to
every answer with but why?. If it is true that activation of cell cycle components causes neuronal death in
Alzheimers disease, what activates this pathway? My
priorities for the immediate future are to try to address
the issue of the functional significance of cell cycle activation in neurons, using the hTau mouse and perhaps
other models. Greene and colleagues have performed
elegant studies in this area [4143], and these will assist our efforts. We have also begun to investigate the
mechanisms that can turn on the cell cycle machinery
in neurons. There are some obvious candidates for
this role, and progress should be rapid in this area. I
hope that 2006 will be another milestone year in AD
research.
Acknowledgements
This seems like a very appropriate place to thank
the people and organizations who have been so helpful
in shaping and supporting my research. Robert D.
268
P. Davies / A long trek down the pathways of cell death in Alzheimers disease
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
P. Davies and A.J. Maloney, Selective loss of central cholinergic neurons in Alzheimers disease, Lancet 2(8000) (1976),
1403.
B.L. Wolozin et al., A neuronal antigen in the brains of
Alzheimer patients, Science 232(4750) (1986), 648650.
I. Vincent, M. Rosado and P. Davies, Mitotic mechanisms in
Alzheimers disease? J Cell Biol 132(3) (1996), 413425.
D.M. Bowen et al., Neurotransmitter-related enzymes and indices of hypoxia in senile dementia and other abiotrophies,
Brain 99(3) (1976), 459496.
E.K. Perry et al., Necropsy evidence of central cholinergic
deficits in senile dementia, Lancet 1(8004) (1977), 189.
P. White et al., Neocortical cholinergic neurons in elderly
people, Lancet 1(8013) (1977), 668671.
J.A. Spillane et al., Selective vulnerability of neurones in organic dementia, Nature 266(5602) (1977), 558559.
P.J. Whitehouse et al., Alzheimer disease: evidence for selective loss of cholinergic neurons in the nucleus basalis, Ann
Neurol 10(2) (1981), 122126.
R.H. Perry et al., Extensive loss of choline acetyltransferase
activity is not reflected by neuronal loss in the nucleus of
Meynert in Alzheimers disease, Neurosci Lett 33(3) (1982),
311315.
B. Zipser and R. McKay, Monoclonal antibodies distinguish
identifiable neurones in the leech, Nature 289(5798) (1981),
549554.
H. Ksiezak-Reding et al., Recognition of tau epitopes by antineurofilament antibodies that bind to Alzheimer neurofibrillary tangles, Proc Natl Acad Sci USA 84(10) (1987), 3410
3414.
A. Scicutella and P. Davies, Characterization of monoclonal
antibodies to galactolipids and uses in studies of dementia, J
Neuropathol Exp Neurol 47(4) (1988), 406419.
B. Wolozin and P. Davies, Alzheimer-related neuronal protein
A68: specificity and distribution, Ann Neurol 22(4) (1987),
521526.
M. Tabaton et al., Alz 50 recognizes abnormal filaments in
Alzheimers disease and progressive supranuclear palsy, Ann
Neurol 24(3) (1988), 407413.
J.A. Doebler et al., Neuronal RNA in relation to Alz-50
immunoreactivity in Alzheimers disease, Ann Neurol 23(1)
(1988), 2024.
B.T. Hyman et al., Alz-50 antibody recognizes Alzheimerrelated neuronal changes, Ann Neurol 23(4) (1988), 371379.
G. Carmel et al., The structural basis of monoclonal antibody
Alz50s selectivity for Alzheimers disease pathology, J Biol
Chem 271(51) (1996), 3278932795.
G.A. Jicha et al., Alz-50 and MC-1, a new monoclonal antibody raised to paired helical filaments, recognize confor-
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
P. Davies / A long trek down the pathways of cell death in Alzheimers disease
[39]
C. Andorfer et al., Cell-cycle reentry and cell death in transgenic mice expressing nonmutant human tau isoforms, J Neurosci 25(22) (2005), 54465454.
[40] C. Andorfer et al., Hyperphosphorylation and aggregation of
tau in mice expressing normal human tau isoforms, J Neurochem 86(3) (2003), 582590.
[41] D.S. Park et al., Cyclin dependent kinase inhibitors and dominant negative cyclin dependent kinase 4 and 6 promote survival
of NGF-deprived sympathetic neurons, J Neurosci 17(23)
(1997), 89758983.
[42]
269
271
Kinsmen Laboratory of Neurological Research , University of British Columbia, Vancouver BC, Canada
Sun Health Research Institute, Sun City, Arizona, USA
Keywords: NSAID, indomethacin, complement, membrane attack complex, immunohistochemistry, reactive microglia
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
272
P.L. McGeer et al. / Inflammation, anti-inflammatory agents and Alzheimer disease: The last 12 years
Fig. 1. Relative mRNA levels for amyloid P and C-reactive protein in the hippocampus of AD and control brain (data from [50]).
P.L. McGeer et al. / Inflammation, anti-inflammatory agents and Alzheimer disease: The last 12 years
273
Fig. 2. Contrast in the immunostaining of AD senile plaques by opsonizing fragments of complement compared with the terminal components
C5b-9. A. Double immunostaining for C4d and CD11c. The opsonizing fragment C4d (light staining) is covalently attached to plaque amyloid
. Reactive microglia expressing high levels of the complement receptor CD11c (dark staining) agglomerate around the C4d ligand. B.
Immunostaining for the MAC (C5b-9). Dystrophic neurites within the senile plaque are prominently stained, indicating lytic attack on trapped
neuronal processes. Note the very weak immunostaining of neuropil threads in the surround.
Fig. 3. Relative mRNA levels for proteins of the complement cascade in the hippocampus of AD and control brains (data from [48]).
274
P.L. McGeer et al. / Inflammation, anti-inflammatory agents and Alzheimer disease: The last 12 years
Acknowledgement
Work in the McGeers laboratory on AD has
been supported by the Jack Brown and Family
Alzheimer Disease Research Fund, the George Hodgson estate, grants from the Alzheimer Society of
Canada/CIHR/Astra-Zeneca and gifts from individual
British Columbians. All experiments were performed
in accordance with protocols approved by the authors
Institutional Review Boards. The authors are named
on patents held by the University of British Columbia
for the treatment of dementia with cyclooxygenase inhibitors.
References
[1]
[2]
[3]
[4]
P.L. McGeer et al. / Inflammation, anti-inflammatory agents and Alzheimer disease: The last 12 years
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
275
276
[41]
[42]
[43]
[44]
[45]
[46]
P.L. McGeer et al. / Inflammation, anti-inflammatory agents and Alzheimer disease: The last 12 years
early Alzheimers disease: an 18-month randomized, doubleblind, placebo-controlled study, Lancet 358 (2001), 455460.
B.A.I. Veld, A. Ruitenberg, L.J. Launer, A. Hofman, M.M.B.
Breteler and B.H.C. Stricker, Duration of non-steroidal antiinflammatory drug use and risk of Alzheimers disease, The
Rotterdam study. Neurobiol. Aging 21(1S) (2000), S204.
J.L. Wallace, Q.J. Pittman and G. Cirino, Nitric oxidereleasing NSAIDs: a novel class of GI-sparing antiinflammatory drugs, Agents & Actions. Suppl. 46 (1995), 121
129.
S. Webster, L.F. Lue, L. Brachova, A.J. Tenner, P.L. McGeer,
K. Terai, D.G. Walker, B. Bradt, N.R. Cooper and J. Rogers,
Molecular and cellular characteristics of the membrane attack
complex, C5b-9, in Alzheimers disease, Neurobiol. Aging 18
(1997), 415421.
S. Webster, A.J. Tenner, T.L. Paulos and D.H. Cribbs, The
mouse C1q A sequence alters beta-amyloid-induced complement activation, Neurobiol. Aging 20 (1999), 297304.
S. Weggen, J.L. Eriksen, P. Das, S.A. Sagi, R. Wang, C.U.
Pietrzik, K.A. Findlay, T.E. Smith, M.P. Murphy, T. Bulter,
D.E. Kang, N. Marquez-Sterling, T.E. Golde and E.H. Koo,
A subset of NSAIDs lower amyloidogenic Abeta-42 independently of cyclooxygenase activity, Nature 414 (2001), 212
216.
G.J. Wolbrink, M.C. Brouwer, S. Buysmann, I.J.M. ten Berge
and C.E. Hack, CRP-mediated activation of complement in
[47]
[48]
[49]
[50]
[51]
[52]
277
Center for Dementia Research, Nathan S. Kline Institute, 140 Old Orangeburg Road, Orangeburg, NY 10962,
USA
b
Department of Psychiatry, New York University, 550 First Ave, New York, NY 10016, USA
c
Department of Cell Biology, New York University, 550 First Ave, New York, NY 10016, USA
d
Mailman Research Center, McLean Hospital, Harvard University, 115 Mill Street, Belmont, MA 02478, USA
Abstract. The identification of cathepsins in amyloid- plaques revealed broad dysfunction of the lysosomal system in Alzheimers disease (AD). Coinciding with the
discovery that proteolysis is required to generate the A-peptide, these findings heralded an era of intense investigation on proteases in neurodegeneration. This review
traces lysosomal system pathology from its early characterization to its origins within
two pathways leading to the lysosome, the endocytic and autophagic pathways. An
understanding has grown about how these two pathways are adversely influenced by
normal brain aging and by genetic and environmental risk factors for AD, resulting in
increased susceptibility of neurons to injury, amyloidogenesis, and neurodegeneration.
Keywords: Amyloid-, cathepsin, apoptosis, endosome, autophagy, necrosis, Alzheimers disease, protease, endocytosis
1. Introduction
In the 1950s, when DeDuve discovered lysosomes
containing dozens of protein and membrane-degrading
enzymes, he not only recognized their importance for
maintaining cell homeostasis but also their destructive
potential [47,48]. The application of these findings
to nervous system disease was immediate; discoveries followed of lysosomal gene defects causing lysosomal storage disorders that were associated with neurodegeneration and cognitive decline. Over the next
decade, germinal work that highlighted the relationship between structure and function of the lysosome
system in normal neurons by Holtzman, Novikoff, and
Corresponding author: Dr. Ralph Nixon, Ph.D., M.D. Nathan
Kline Institute, New York University School of Medicine, 140 Old
Orangeburg Road, Orangeburg, NY 10962, USA. Tel.: +1 845 398
5423; Fax: +1 845 398 5422; E-mail: Nixon@nki.rfmh.org.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
278
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
the diversity of proteases and their complex roles began to be more widely appreciated. Interest in proteases in AD was also fueled at this time by the discovery that amyloid- peptide was derived by proteolytic processing of a larger protein, amyloid- protein
precursor (APP). An international meeting at the NIH
in 1991, dedicated to proteolysis in AD pathogenesis,
heralded a new era of intense research on proteases in
neurodegenerative diseases [125].
As part of early investigations in our laboratory
on proteases of the calpain and lysosomal systems in
neurodegeneration, we raised antibodies to cathepsins
which, when applied to AD brain, revealed robust and
widespread mobilization of the lysosomal system in
neurons [25]. The full report of these findings in 1990
in PNAS [30] stimulated considerable interest in part
because the study represented the initial attempt to link
APP processing in brain to the activity of a particular proteolytic system. Among the findings in this report were that cathepsin-positive (i.e. lysosome-related)
vesicles accumulated in most neurons of targeted brain
regions in AD and that the concentrations of cathepsin immunoreactivity in senile plaques were exceptionally high, an observation also made independently by
Bernstein [11]. Moreover, the cathepsins (Cat) D and
Cat B in senile plaques were shown by histochemical assays to be enzymatically active and also to be
present extracellularly to some degree. Companion
studies from our laboratory, including mRNA expression analysis, showed that these changes reflected a
generalized up-regulation of lysosomal system activity
[26,31,37]. These observations have been confirmed
and extended in AD brain and mouse models of AD [12,
86,122], most recently by proteomic analyses of neuritic plaques [106] and by gene expression profiling
studies in single affected neurons in AD brain [22,23,
67], which show that Cat D expression is sustained
at high levels even after the expression of most other
transcripts has declined. Based on these observations,
we proposed that lysosomal system dysfunction, especially within degenerating or dystrophic neurites, could
impair neuron survival and promote the amyloidogenic
processing of APP characteristic of AD neuropathology.
Research on the lysosomal system expanded greatly
in the years following our 1990 report, and the cumulative findings underscore the close relationship between
dysfunction of this system and neurological disease,
especially AD. A deeper understanding of the two major pathways of the lysosome system, endocytosis and
autophagy, has further clarified how dysfunction of the
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
Fig. 1. Representation of the Lysosomal System. The lysosomal system is comprised of two main pathways, the Autophagic Pathway and
the Endocytic Pathway as discussed in the text and cited reviews. The
major organelles of the Autophagic Pathway are a pre-autophagic
structure (PAS) which sequesters large areas of cytoplasm within a
double membrane-limited autophagosome (AP). This organelle interacts with either a lysosome to form an autophagolysosome (AL) or
a late endosome/multivesicular body (LE/MVB) to form an amphisome. Efficient digestion of substrates within these proteolytically
competent compartments, in both cases, yields a lysosome. Internalized materials entering the Endocytic Pathway in clathrin-coated
vesicles are directed to early (sorting) endosomes (EE). Specific constituents are dissociated within EEs and recycled back to the plasmalemmal surface and others are targeted further along the pathway and degraded when EE mature to LE/MVB as they acidify and
receive hydrolases.
before lysosome fusion [9,53,54]. These different lysosomal system compartments, each dynamically changing in substrate and hydrolase composition and internal pH, represent diverse capabilities for protein processing, including a potential for generating pathogenic
polypeptide fragments, especially when the efficiency
of the lysosomal system is impaired, as seen in AD.
279
280
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
type, these mice exhibit aging-related neurodegenerative changes of basal forebrain cholinergic neurons
(BFCN), hippocampus, and neocortex in the absence
of amyloid- deposition or NFT formation [83]. Endosomal pathology, like that in human AD and DS brain,
appears at an early age in the same neuronal populations. Notably, both the endosomal abnormalities and
degenerative changes in the BFCN are reversed when
Ts65Dn mice are made diploid for App [32], establishing that App triplication is directly related to endosome
dysfunction and neurodegeneration. The pattern of endosome pathology seen in AD is not seen in normal
aging brain nor has it been seen in other neurodegenerative diseases [36] except NPC a disease that shares
some pathobiological features with AD [91].
The recent surge of interest in macroautophagy has
led to a recognition that this process is frequently
involved in disease states, including AD. Using the
unique morphologies of autophagic vacuoles to detect autophagy in pathological specimens, investigators have reported autophagic vacuole pathology
of varying severity within affected neurons in several neurodegenerative states [148]. The macroautophagy pathology in AD brain is particularly striking [127]. Autophagic vacuoles, representing all stages
of the macroautophagic process from sequestration to
degradation, accumulate grossly in dystrophic neurites.
Lysosomes have long been known to be abundant in
dystrophic neurites but the marked accumulation of autophagosomes that do not have lysosomal hydrolase or
LAMPs, an early stage of macroautophagy, in addition
to late AVs, implies delayed or impaired progression
of macroautophagy and possibly dysfunctional proteolysis, since early AVs are rarely seen in normal brain.
Although AV accumulations are not specific to the degenerative phenomena of AD [3,93,143,189], the extensive neuritic dystrophy [111,152] and the characteristic gross distension of these neurites predominantly
by AVs in AD are not typical features of other neurodegenerative diseases [8]. The same extensive autophagy
pathology develops in the PS/APP transgenic mouse
model of AD [186] and begins to appear at young ages
before amyloid- pathology indicating that macroautophagy induction is an early response in the disease
and not solely a consequence of amyloid deposition.
Indeed, accumulating AVs are a site of A generation [186].
5. The lysosomal system and -amyloidogenesis
Our 1990 PNAS report coincided with emerging interest in the processing of APP to A. Although Cat
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
D was only one of the many lysosomal enzymes identified in plaques, its prominence there and its abnormally high expression in neurons in AD prompted considerable attention to this protease as a possible APP
secretase [7,62]. Remarkably, Cat D emerged from a
long list of APP-cleaving proteases as one of a very
few exhibiting both -secretase activity toward APP
model substrates [100,109,149,180], and -secretase
activity which was enhanced by the Swedish FAD mutation [18,39,52,74,109]. Enthusiasm about Cat D
in amyloidogenesis dampened, however, when Cat D
deletion proved to have minimal effects on A secretion [150] and several studies discounted lysosomes as
a site of A generation [75,78]. Following these early
negative findings, a steady flow of evidence has implicated lysosomal system compartments upstream in
the endocytic and autophagic pathways, including the
ones that become morphologically abnormal early in
AD. In AD, A has been identified at three intraneuronal sites within the lysosomal system: rab5-positive
endosomes [34]; autophagic vacuoles [187]; and multivesicular bodies [165] which could be related to either the endocytic or autophagic pathways. It is now
believed that these cellular compartments may generate A, not necessarily because of their cathepsins, but
because they are also rich sources of - and -APP
secretases.
A generation has been proposed to occur in the
ER [40,72], medial Golgi saccules [168], trans Golgi
network [174,181], autophagic vacuoles [187,188]
and endosomes of the endocytic pathway [77,99,160].
Among these sites, only endosomes have been shown
to be altered morphologically before amyloid begins to
deposit in AD brain. Endosomes contain -site APP
cleaving enzyme (BACE) [85,178], presenilin [101],
and APP [75,76,128]: also, CTF, the -secretase
cleaved carboxyl terminal domain of APP, is generated directly in endosomes [71,112,113]. Earlier studies demonstrated that A production falls markedly
when APP internalization is reduced by APP mutagenesis or blocking endocytosis [99,139,160] and rises
substantially when endosome function specifically is
modified [71,112]. Notably, A generation increases
substantially when either of the two early appearing features of endosome pathology in AD, rab5-driven endosome enlargement or MPR-driven increased cathepsin
delivery to early endosomes, is reproduced in cells [71,
112]. Antibodies to the APP -cleavage site, which
target endosomal APP processing, significantly lower
A production and are being explored as potential therapeutic immunization strategies [4,134].
281
The macroautophagy branch of the lysosomal system has also been shown recently to be a pathway for
A peptide generation [186,188]. AVs isolated from
several different tissue sources contain all of the components required for A generation and are enriched in
components of the -secretase complex and presenilindependent -secretase activity [138,186,188]. Immunoreactivity for these components is robust in AVs
that accumulate grossly in dystrophic neurites within
senile plaques in AD and the PS/APP mouse model
of AD. Interestingly, autophagy-related rimmed vacuoles containing APP, A, BACE and presenilin [5,6]
also accumulate in inclusion body myositis, a condition
in which amyloid- is deposited outside the nervous
system [6]. The localization of A and A-generating
machinery in pathologically accumulating AVs is not
coincidental. A is generated during macroautophagy;
inducing or inhibiting macroautophagy by modulating mTOR kinase elicits parallel changes in extent of
AV proliferation and A production [186]. Macroautophagy may play a relatively minor role in constitutive
A generation in the normal brain because, at the slow
rates of macroautophagy, AVs do not build up and the
A generated in this system is usually degraded by the
cathepsins in lysosomes [79,80]. In AD, however, the
large accumulations of AVs in dystrophic neurites, reflecting delayed maturation of AVs to lysosomes, could
contribute substantially to defective proteolysis and terminal degradation and amyloidogenesis.
282
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
7. Conclusion
Interest in the lysosomal system and its cathepsins as
agents and mediators of pathology in disease states has
risen exponentially in the past decade. Nowhere is this
growing interest more apparent than in the investigation of neurodegenerative diseases. Early studies of the
lysosomal system in AD identified a robust mobilization of this system in neurons (e.g., lysosome proliferation, increased acid hydrolase expression), even in the
most mildly affected cell populations. Later investigations showed that stimulated lysosomal degradation
may be a crucial pro-survival response to accumulating
damaged and defective proteins in aged and diseased
neurons. Mobilization of the lysosomal system in AD
has now been traced to heightened activity and eventual
dysfunction of its two main branches, the autophagic
and endocytic pathways, which serve critical roles in
the specialized functions and survival of neurons, in
addition to protein turnover. The autophagic and endocytic pathways, which are also known to be sites of A
production, begin to fail at the earliest stages of AD.
We are learning that many genetic and environmental risk factors for AD drive the dysfunction of these
pathways, and thereby promote A generation and,
as importantly, impede the vital signaling and protein
turnover functions of these two pathways. The failure
of the lysosomal system on several different levels in
AD not only increases the vulnerability of neurons to
degeneration but may also trigger and mediate aspects
of cell death.
Acknowledgements
We thank Heather Braunstein for her assistance
in manuscript preparation and Corrinne Peterhoff for
graphics. We gratefully acknowledge the National Institute on Aging for support of our studies from their
inception to the present (currently AG017617) and the
Alzheimers Association for additional support.
283
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
284
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
6 genes and the risk of Alzheimers disease, Neurosci Lett
288(1) (2000), 2124.
N.E. Bishop, Dynamics of endosomal sorting, Int Rev Cytol
232 (2003), 157.
T. Borsello, K. Croquelois, J.P. Hornung and P.G. Clarke, Nmethyl-d-aspartate-triggered neuronal death in organotypic
hippocampal cultures is endocytic, autophagic and mediated
by the c-Jun N-terminal kinase pathway, Eur J Neurosci 18(3)
(2003), 473485.
L.E. Broker, F.A. Kruyt and G. Giaccone, Cell death independent of caspases: a review, Clin Cancer Res 11(9) (2005),
31553162.
A.M. Brown, D.M. Tummolo, M.A. Spruyt, J.S. Jacobsen
and J. Sonnenberg-Reines, Evaluation of cathepsins D and
G and EC 3.4.24.15 as candidate beta-secretase proteases
using peptide and amyloid precursor protein substrates, J
Neurochem 66(6) (1996), 24362445.
U.T. Brunk, H. Dalen, K. Roberg and H.B. Hellquist, Photooxidative disruption of lysosomal membranes causes apoptosis of cultured human fibroblasts, Free Radic Biol Med 23(4)
(1997), 616626.
U.T. Brunk, C.B. Jones and R.S. Sohal, A novel hypothesis of
lipofuscinogenesis and cellular aging based on interactions
between oxidative stress and autophagocytosis, Mutat Res
275(36) (1992), 395403.
U.T. Brunk and A. Terman, The mitochondrial-lysosomal
axis theory of aging: accumulation of damaged mitochondria
as a result of imperfect autophagocytosis, Eur J Biochem
269(8) (2002), 19962002.
L.M. Callahan, N. Chow, J.E. Cheetham, C. Cox and P.D.
Coleman, Analysis of message expression in single neurons
of Alzheimers disease brain, Neurobiol Aging 19(1 Suppl)
(1998), S99S105.
L.M. Callahan, W.A. Vaules and P.D. Coleman, Quantitative
decrease in synaptophysin message expression and increase
in cathepsin D message expression in Alzheimer disease neurons containing neurofibrillary tangles, J Neuropathol Exp
Neurol 58(3) (1999), 275287.
N. Canu, R. Tufi, A.L. Serafino, G. Amadoro, M.T. Ciotti
and P. Calissano, Role of the autophagic-lysosomal system
on low potassium-induced apoptosis in cultured cerebellar
granule cells, J Neurochem 92(5) (2005), 12281242.
A. Cataldo and R. Nixon, A relationship between extracellular localization of lysosomal proteinases and amyloid deposition in Alzheimers disease, Soc Neurosci Abstr 1378
(1989).
A.M. Cataldo, J.L. Barnett, S.A. Berman, J. Li, S. Quarless,
S. Bursztajn, C. Lippa and R.A. Nixon, Gene expression and
cellular content of cathepsin D in Alzheimers disease brain:
evidence for early up-regulation of the endosomal-lysosomal
system, Neuron 14(3) (1995), 671680.
A.M. Cataldo, J.L. Barnett, D.M. Mann and R.A. Nixon,
Colocalization of lysosomal hydrolase and beta-amyloid in
diffuse plaques of the cerebellum and striatum in Alzheimers
disease and Downs syndrome, J Neuropathol Exp Neurol
55(6) (1996), 704715.
A.M. Cataldo, J.L. Barnett, C. Pieroni and R.A. Nixon,
Increased neuronal endocytosis and protease delivery to
early endosomes in sporadic Alzheimers disease: neuropathologic evidence for a mechanism of increased betaamyloidogenesis, J Neurosci 17(16) (1997), 61426151.
A.M. Cataldo, D.J. Hamilton and R.A. Nixon, Lysosomal
abnormalities in degenerating neurons link neuronal com-
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[74]
285
lization by compounds that activate p53-independent apoptosis, Proc Natl Acad Sci USA 102(1) (2005), 192197.
C. Esselens, V. Oorschot, V. Baert, T. Raemaekers, K. Spittaels, L. Serneels, H. Zheng, P. Saftig, B. De Strooper,
J. Klumperman and W. Annaert, Presenilin 1 mediates the
turnover of telencephalin in hippocampal neurons via an autophagic degradative pathway, J Cell Biol 166(7) (2004),
10411054.
G. Evin, R. Cappai, Q.X. Li, J.G. Culvenor, D.H. Small, K.
Beyreuther and C.L. Masters, Candidate gamma-secretases
in the generation of the carboxyl terminus of the Alzheimers
disease beta A4 amyloid: possible involvement of cathepsin
D, Biochemistry 34(43) (1995), 1418514192.
E.T. Fossel, C.L. Zanella, J.G. Fletcher and K.K. Hui, Cell
death induced by peroxidized low-density lipoprotein: endopepsis, Cancer Res 54(5) (1994), 12401248.
Z. Galdzicki and R.J. Siarey, Understanding mental retardation in Downs syndrome using trisomy 16 mouse models,
Genes Brain Behav 2(3) (2003), 167178.
L. Gan, S. Ye, A. Chu, K. Anton, S. Yi, V.A. Vincent, D. von
Schack, D. Chin, J. Murray, S. Lohr, L. Patthy, M. GonzalezZulueta, K. Nikolich and R. Urfer, Identification of cathepsin
B as a mediator of neuronal death induced by Abeta-activated
microglial cells using a functional genomics approach, J Biol
Chem 279(7) (2004), 55655572.
F.G. Gervais, R. Singaraja, S. Xanthoudakis, C.A. Gutekunst,
B.R. Leavitt, M. Metzler, A.S. Hackam, J. Tam, J.P. Vaillancourt, V. Houtzager, D.M. Rasper, S. Roy, M.R. Hayden and
D.W. Nicholson, Recruitment and activation of caspase-8 by
the Huntingtin-interacting protein Hip-1 and a novel partner
Hippi, Nat Cell Biol 4(2) (2002), 95105.
S.D. Ginsberg, S.E. Hemby, V.M. Lee, J.H. Eberwine
and J.Q. Trojanowski, Expression profile of transcripts in
Alzheimers disease tangle-bearing CA1 neurons, Ann Neurol 48(1) (2000), 7787.
A.L. Goldberg, Protein degradation and protection against
misfolded or damaged proteins, Nature 426(6968) (2003),
895899.
I. Gout, G. Middleton, J. Adu, N.N. Ninkina, L.B. Drobot,
V. Filonenko, G. Matsuka, A.M. Davies, M. Waterfield and
V.L. Buchman, Negative regulation of PI 3-kinase by Ruk, a
novel adaptor protein, Embo J 19(15) (2000), 40154025.
D.I. Graham and P.L. Lantos, Greenfields Neuropathology,
New York, Arnold, 2002.
O.M. Grbovic, P.M. Mathews, Y. Jiang, S.D. Schmidt, R.
Dinakar, N.B. Summers-Terio, B.P. Ceresa, R.A. Nixon
and A.M. Cataldo, Rab5-stimulated up-regulation of the endocytic pathway increases intracellular beta-cleaved amyloid precursor protein carboxyl-terminal fragment levels and
Abeta production, J Biol Chem 278(33) (2003), 31261
31268.
J.P. Greenfield, J. Tsai, G.K. Gouras, B. Hai, G. Thinakaran,
F. Checler, S.S. Sisodia, P. Greengard and H. Xu, Endoplasmic reticulum and trans-Golgi network generate distinct
populations of Alzheimer beta-amyloid peptides, Proc Natl
Acad Sci USA 96(2) (1999), 742747.
T. Grune, R. Shringarpure, N. Sitte and K. Davies, Agerelated changes in protein oxidation and proteolysis in mammalian cells, J Gerontol A Biol Sci Med Sci 56(11) (2001),
B459B467.
F. Gruninger-Leitch, P. Berndt, H. Langen, P. Nelboeck and
H. Dobeli, Identification of beta-secretase-like activity using a mass spectrometry-based assay system, Nat Biotechnol
18(1) (2000), 6670.
286
[75]
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
C. Haass, A.Y. Hung, M.G. Schlossmacher, D.B. Teplow and
D.J. Selkoe, beta-amyloid peptide and a 3-kDa fragment are
derived by distinct cellular mechanisms, J Biol Chem 268(5)
(1993), 30213024.
C. Haass, E.H. Koo, A. Mellon, A.Y. Hung and D.J. Selkoe,
Targeting of cell-surface beta-amyloid precursor protein to
lysosomes: alternative processing into amyloid-bearing fragments, Nature 357(6378) (1992), 500503.
C. Haass, M.G. Schlossmacher, A.Y. Hung, C. Vigo-Pelfrey,
A. Mellon, B.L. Ostaszewski, I. Lieberburg, E.H. Koo, D.
Schenk, D.B. Teplow et al., Amyloid beta-peptide is produced by cultured cells during normal metabolism [see comments], Nature 359(6393) (1992), 322325.
C. Haass and D.J. Selkoe, Cellular processing of betaamyloid precursor protein and the genesis of amyloid betapeptide, Cell 75(6) (1993), 10391042.
H. Hamazaki, A beta-amyloid peptide variant related with
familial Alzheimers disease and hereditary cerebral hemorrhage with amyloidosis is poorly eliminated by cathepsin D,
FEBS Lett 397(23) (1996), 313315.
H. Hamazaki, Cathepsin D is involved in the clearance
of Alzheimers beta-amyloid protein, FEBS Lett 396(23)
(1996), 139142.
M. Heinrich, M. Wickel, W. Schneider-Brachert, C. Sandberg, J. Gahr, R. Schwandner, T. Weber, P. Saftig, C. Peters,
J. Brunner, M. Kronke and S. Schutze, Cathepsin D targeted
by acid sphingomyelinase-derived ceramide [published erratum appears in EMBO J 2000 Jan 17;19(2):315], Embo J
18(19) (1999), 52525263.
H.B. Hellquist, I. Svensson and U.T. Brunk, Oxidant-induced
apoptosis: a consequence of lethal lysosomal leak? Redox
Report 3(1) (1997), 6570.
D.M. Holtzman, D. Santucci, J. Kilbridge, J. Chua-Couzens,
D.J. Fontana, S.E. Daniels, R.M. Johnson, K. Chen, Y. Sun,
E. Carlson, E. Alleva, C.J. Epstein and W.C. Mobley, Developmental abnormalities and age-related neurodegeneration
in a mouse model of Down syndrome, Proc Natl Acad Sci
USA 93(23) (1996), 1333313338.
E. Holtzman, Lysosomes, New York, Plenum Press, 1989.
J.T. Huse, D.S. Pijak, G.J. Leslie, V.M. Lee and R.W. Doms,
Maturation and endosomal targeting of beta-site amyloid
precursor protein-cleaving enzyme. The Alzheimers disease
beta-secretase, J Biol Chem 275(43) (2000), 3372933737.
K. Ii, H. Ito, E. Kominami and A. Hirano, Abnormal distribution of cathepsin proteinases and endogenous inhibitors
(cystatins) in the hippocampus of patients with Alzheimers
disease, parkinsonism-dementia complex on Guam, and senile dementia and in the aged, Virchows Arch A Pathol Anat
Histopathol 423(3) (1993), 185194.
K. Ikegami, T. Kimura, S. Katsuragi, T. Ono, H. Yamamoto,
E. Miyamoto and T. Miyakawa, Immunohistochemical examination of phosphorylated tau in granulovacuolar degeneration granules, Psychiatry Clin Neurosci 50(3) (1996), 137
140.
K. Isahara, Y. Ohsawa, S. Kanamori, M. Shibata, S. Waguri,
N. Sato, T. Gotow, T. Watanabe, T. Momoi, K. Urase, E.
Kominami and Y. Uchiyama, Regulation of a novel pathway
for cell death by lysosomal aspartic and cysteine proteinases,
Neuroscience 91(1) (1999), 233249.
R. Ishisaka, T. Utsumi, T. Kanno, K. Arita, N. Katunuma,
J. Akiyama and K. Utsumi, Participation of a cathepsin Ltype protease in the activation of caspase-3, Cell Struct Funct
24(6) (1999), 465470.
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]
[102]
[103]
[104]
[105]
[106]
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
[107]
[108]
[109]
[110]
[111]
[112]
[113]
[114]
[115]
[116]
[117]
[118]
[119]
[120]
[121]
[122]
[123]
[124]
[125]
[126]
[127]
[128]
[129]
[130]
[131]
[132]
[133]
[134]
[135]
287
L. Myllykangas, J. Tyynela, A. Page-McCaw, G.M. Rubin, M.J. Haltia and M.B. Feany, Cathepsin D-deficient
Drosophila recapitulate the key features of neuronal ceroid
lipofuscinoses, Neurobiol Dis 19(12) (2005), 194199.
I. Nagano, T. Murakami, M. Shiote, Y. Manabe, S. Hadano, Y.
Yanagisawa, J.E. Ikeda and K. Abe, Single-nucleotide polymorphisms in uncoding regions of ALS2 gene of Japanese
patients with autosomal-recessive amyotrophic lateral sclerosis, Neurol Res 25(5) (2003), 505509.
Y. Nakamura, M. Takeda, H. Suzuki, H. Hattori, K. Tada, S.
Hariguchi, S. Hashimoto and T. Nishimura, Abnormal distribution of cathepsins in the brain of patients with Alzheimers
disease, Neurosci Lett 130(2) (1991), 195198.
R.A. Nixon, Niemann-Pick Type C disease and Alzheimers
disease: the APP-endosome connection fattens up, Am J
Pathol 164(3) (2004), 757761.
R.A. Nixon, Endosome function and dysfunction in
Alzheimers disease and other neurodegenerative diseases,
Neurobiol Aging (2005), in press.
R.A. Nixon and Banner, Proteases and Protease Inhibitors
in Alzheimers Disease Pathogenesis, Proceedings of a conference. Bethesda, Maryland, December 1618, 1991, 1992.
R.A. Nixon, J. Wegiel, A. Kumar, W.H. Yu, C. Peterhoff,
A. Cataldo and A.M. Cuervo, Extensive involvement of
autophagy in Alzheimer disease: an immuno-electron microscopy study, J Neuropathol Exp Neurol 64(2) (2005),
113122.
R.A. Nixon, W.H. Yu, A.M. Cuervo, A. Kumar, D.S. Yang
and C.M. Peterhoff, Autophagy in Alzheimers Disease:
Failure of a Neuroprotective Mechanism, in: Alzheimers
Disease and Related Disorders: Research Advances, I.
Khalid and B. Winblad, eds, Bucharest, Ana Aslan International Academy of Aging 10 (2005), in press.
C. Nordstedt, G.L. Caporaso, J. Thyberg, S.E. Gandy and P.
Greengard, Identification of the Alzheimer beta/A4 amyloid
precursor protein in clathrin-coated vesicles purified from
PC12 cells, J Biol Chem 268(1) (1993), 608612.
A. Novikoff, Lysosomes in nerve cells, The Neuron. NY,
Elsevier Publishing Co.,: 319ff, 1967.
J. Nylandsted, M. Gyrd-Hansen, A. Danielewicz, N. Fehrenbacher, U. Lademann, M. Hoyer-Hansen, E. Weber, G.
Multhoff, M. Rohde and M. Jaattela, Heat shock protein 70
promotes cell survival by inhibiting lysosomal membrane
permeabilization, J Exp Med 200(4) (2004), 425435.
K. Ollinger, Inhibition of cathepsin D prevents free-radicalinduced apoptosis in rat cardiomyocytes, Arch Biochem Biophys 373(2) (2000), 346351.
T. Olsson, J. Nygren, K. Hakansson, C. Lundblad, A. Grubb,
M.L. Smith and T. Wieloch, Gene deletion of cystatin C
aggravates brain damage following focal ischemia but mitigates the neuronal injury after global ischemia in the mouse,
Neuroscience 128(1) (2004), 6571.
A. Otomo, S. Hadano, T. Okada, H. Mizumura, R. Kunita, H.
Nishijima, J. Showguchi-Miyata, Y. Yanagisawa, E. Kohiki,
E. Suga, M. Yasuda, H. Osuga, T. Nishimoto, S. Narumiya
and J.E. Ikeda, ALS2, a novel guanine nucleotide exchange
factor for the small GTPase Rab5, is implicated in endosomal
dynamics, Hum Mol Genet 12(14) (2003), 16711687.
P. Paganetti, V. Calanca, C. Galli, M. Stefani and M. Molinari, beta-site specific intrabodies to decrease and prevent
generation of Alzheimers Abeta peptide, J Cell Biol 168(6)
(2005), 863868.
A. Papassotiropoulos, M. Bagli, O. Feder, F. Jessen, W.
Maier, M.L. Rao, M. Ludwig, S.G. Schwab and R. Heun,
288
[136]
[137]
[138]
[139]
[140]
[141]
[142]
[143]
[144]
[145]
[146]
[147]
[148]
[149]
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
Genetic polymorphism of cathepsin D is strongly associated
with the risk for developing sporadic Alzheimers disease,
Neurosci Lett 262(3) (1999), 171174.
A. Papassotiropoulos, M. Bagli, A. Kurz, J. Kornhuber, H.
Forstl, W. Maier, J. Pauls, N. Lautenschlager and R. Heun,
A genetic variation of cathepsin D is a major risk factor for
Alzheimers disease, Ann Neurol 47(3) (2000), 399403.
C. Paquet, A.T. Sane, M. Beauchemin and R. Bertrand,
Caspase- and mitochondrial dysfunction-dependent mechanisms of lysosomal leakage and cathepsin B activation in
DNA damage-induced apoptosis, Leukemia 19(5) (2005),
784791.
S.H. Pasternak, R.D. Bagshaw, M. Guiral, S. Zhang, C.
A. Ackerley, B.J. Pak, J.W. Callahan and D.J. Mahuran, Presenilin-1, nicastrin, amyloid precursor protein, and
gamma-secretase activity are co-localized in the lysosomal
membrane, J Biol Chem 278(29) (2003), 2668726694.
R.G. Perez, S. Soriano, J.D. Hayes, B. Ostaszewski, W. Xia,
D.J. Selkoe, X. Chen, G.B. Stokin and E.H. Koo, Mutagenesis identifies new signals for beta-amyloid precursor protein endocytosis, turnover, and the generation of secreted
fragments, including Abeta42, J Biol Chem 274(27) (1999),
1885118856.
P.J. Peters, A. Mironov, Jr., D. Peretz, E. van Donselaar,
E. Leclerc, S. Erpel, S.J. DeArmond, D.R. Burton, R.A.
Williamson, M. Vey and S.B. Prusiner, Trafficking of prion
proteins through a caveolae-mediated endosomal pathway, J
Cell Biol 162(4) (2003), 703717.
A. Pope and R.A. Nixon, Proteases of human brain, Neurochem Res 9(3) (1984), 291323.
V.P. Prasher, M.J. Farrer, A.M. Kessling, E.M. Fisher, R.J.
West, P.C. Barber and A.C. Butler, Molecular mapping of
Alzheimer-type dementia in Downs syndrome, Ann Neurol
43(3) (1998), 380383.
Z.H. Qin, Y. Wang, K.B. Kegel, A. Kazantsev, B.L. Apostol, L.M. Thompson, J. Yoder, N. Aronin and M. DiFiglia,
Autophagy regulates the processing of amino terminal huntingtin fragments, Hum Mol Genet 12(24) (2003), 32313244.
B. Ravikumar, A. Stewart, H. Kita, K. Kato, R. Duden and
D.C. Rubinsztein, Raised intracellular glucose concentrations reduce aggregation and cell death caused by mutant
huntingtin exon 1 by decreasing mTOR phosphorylation and
inducing autophagy, Hum Mol Genet 12(9) (2003), 985994.
B. Ravikumar, C. Vacher, Z. Berger, J.E. Davies, S. Luo, L.G.
Oroz, F. Scaravilli, D.F. Easton, R. Duden, C.J. OKane and
D.C. Rubinsztein, Inhibition of mTOR induces autophagy
and reduces toxicity of polyglutamine expansions in fly
and mouse models of Huntington disease, Nat Genet 36(6)
(2004), 585595.
K. Roberg, U. Johansson and K. Ollinger, Lysosomal release
of cathepsin D precedes relocation of cytochrome c and loss
of mitochondrial transmembrane potential during apoptosis
induced by oxidative stress, Free Radic Biol Med 27(1112)
(1999), 12281237.
K. Roberg nd K. Ollinger, Oxidative stress causes relocation
of the lysosomal enzyme cathepsin D with ensuing apoptosis
in neonatal rat cardiomyocytes, Am J Pathol 152(5) (1998),
11511156.
D.C. Rubinsztein, M. DiFiglia, N. Heintz, R.A. Nixon, Z.H.
Qin, B. Ravikumar, L. Stefanis and A.M. Tolkovsky, Autophagy and its possible roles in nervous system diseases,
damage and repair, Autophagy 1(1) (2005), 1122.
G. Sadik, H. Kaji, K. Takeda, F. Yamagata, Y. Kameoka, K.
Hashimoto, K. Miyanaga and T. Shinoda, In vitro processing
[150]
[151]
[152]
[153]
[154]
[155]
[156]
[157]
[158]
[159]
[160]
[161]
[162]
[163]
[164]
[165]
[166]
R.A. Nixon and A.M. Cataldo / Lysosomal system pathways: Genes to neurodegeneration in Alzheimers disease
[167]
[168]
[169]
[170]
[171]
[172]
[173]
[174]
[175]
[176]
[177]
[178]
[179]
[180]
[181]
[182]
[183]
[184]
[185]
[186]
[187]
[188]
[189]
289
291
1. Introduction
Although the association of aluminum and Alzheimers disease did not begin with me, my 1980
paper [19] coauthored with Arnold Brody entitled
Alzheimers Disease: X-ray spectrographic evidence
of aluminum accumulation in neurofibrillary tanglebearing neurons, provided critical data that extended
this association to the cellular level of resolution. The
paper greatly raised the awareness of the association of
this non-essential trace element and Alzheimers disease and has stimulated further research, discussion and
controversy that continue to this day. Over the past 25
years, this paper has been formally cited over 600 times
and literally hundreds of times I have been asked to discuss it and its implications at meetings and seminars. I
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
292
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
ers in Vermont, a location with active asbestos, granite, talc and marble quarries and mines, commonly suffered from such occupational lung diseases and this was
the basis for an active Specialized Centers of Research
(SCOR) program at the University of Vermont College
of Medicine funded by the Heart, Lung and Blood Institute of the NIH. At the time, Dr. Brody ran a very
productive facility within Vermonts SCOR program
that was engaged in the study of human and experimental animal-derived lung tissues using the approach
of scanning electron microscopy coupled with energy
dispersive x-ray microprobe analysis (SEM-XES). We
quickly became friends and as an extension of our
friendship, sought ways in which we could collaborate
scientifically.
Although the microprobe analytic techniques Brody
and others were using were very sensitive, at the
time, very little research had been done employing
SEM-XES to study brain specimens, especially human tissues. However, I was aware of the publications
emerging from the laboratories of Dr. Donald CrapperMcLachlan and colleagues in Toronto. In 1973 [2],
they published the results of a study demonstrating that
Alzheimers disease brain tissues showed a 2 to 3-fold
increase in aluminum concentrations when compared
to normal control tissues. A subsequent study [3] provided further data indicating considerable regional variation in aluminum concentration in Alzheimers disease brain tissue and suggested that the regions with
the highest concentration of aluminum were those containing the greatest number of neurofibrillary tangles
(NFTs). The implication was that aluminum played a
role in the formation of the NFT, a cardinal lesion of
Alzheimers disease. The rationale behind these two
studies had been the earlier publications by Terry and
Pena [26] and of Klatzo, Wisniewski, and Streicher [12]
demonstrating the acute induction of widespread NFTs
in cerebral cortical, brain stem and spinal cord neurons
of rabbits following direct exposure of the brain to a variety of aluminum-containing compounds. In the early
years, it was argued that the aluminum-induced tangles
of the rabbit were composed of straight neurofilaments
and therefore were entirely different from that of human paired-helical filaments [27]. Subsequent studies
by Savory and colleagues [11,23,24] have pointed out
that there are many shared constituents between these
experimental lesions and those of man.
The studies by Crapper-McLachlan employed atomic
absorption spectrometry and provided bulk tissue elemental concentrations within relatively small tissue
samples. Inherent in this kind of bulk analysis is the in-
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
ages which will examine spectra automatically and detect and quantify the individual elements present. At
the time we were working, the steps for the analysis
of the spectra we collected had to be done individually and painstakingly by hand. The instrument had
to be carefully aligned and adjusted to maximize collection of a clean spectrum. For such critical issues,
Arnie Brody played an essential role and was a world
authority. When we got stumped, Mr. Joe Geller,
then an analytical specialist working with the JEOL
company, added his considerable technical expertise
and experience. It was also clear that we had added
high concentrations of silver to the tissues and that this
increased the amount of background (non-specific or
Bremstrallung) x-rays which were produced. We were
concerned that there might have been inadvertent aluminum contamination in the stain ingredients and these
ingredients were probed directly, as were non-specific
stain deposits within the tissue sections. Such analyses
never showed evidence of detectable aluminum-related
signals using the same instrumentation.
From the beginning, it was clear that we were attempting to detect very low concentrations of aluminum
in these tissues. This required us to set criteria for
293
294
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
Arnie and I collated our data, wrote it up, and sent the
manuscript to Science. After the usual anxious waiting
period, we received three very supportive reviews, yet
the paper was rejected. We were disappointed by this
and wrote to the editor-in-chief pointing to the very
positive reviews as well as indicating that Science had
published Crapper-McLachlins original Alzheimers
disease bulk aluminum analysis paper [2]. After a short
delay, the paper was then accepted for publication with
very little revision.
Soon after the publication of the paper, I was faced
with a modest number of inquiries from the press.
Some calls came in asking for interviews, comments
and statements on the significance of our findings. We
had not issued a press release about the paper and I was
not ready for the extent of interest in our results. About
three months after the paper appeared, I received a huge
flurry of calls about the work coming from all over the
world. These inquiries asked for my interpretation of
the results with respect to potential hazards of human
exposure to aluminum in the form of pots and pans as
well as other aluminum-containing food substances. I
was puzzled by this renewal of interest and soon found
that Dr. Steven Levick had just published a short letter to
the editor in the New England Journal of Medicine [14]
citing our work and raising the potential health risks of
using aluminum pots and pans. I had never heard of
Dr. Levick but later found out that he was, at the time, a
psychiatry resident at Yale. I later learned that Levick
had also received numerous calls for comments on his
letter. He had not done any research in the area other
than noting that an aluminum pan he used in his humble residents apartment showed considerable erosion
causing him to wonder in a rather public fashion about
where the aluminum had gone and what were the consequences of exposure of this type. Although we had not
discussed the issue directly in our paper, Levick raised
an important issue, namely, could aluminum represent
the etiology of Alzheimers disease and did exposure to
aluminum-containing products represent a health hazard. This potential concept really stirred up interest
by the lay press and was like pouring gasoline on a
smoldering fire. The phone calls, interviews, stories
on TV, radio and in the press throughout the world escalated and have continued this interest over the years.
As scientists, at times we are often unaware of the impact that our findings may have once they have been
set free on the public at large and been subjected to
the interpretation of poorly informed and scientifically
naive reporters. We assume that the scientific process
rules the day but as any one who has participated in
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
295
Fig. 3. Line scan through an NFT-bearing neuron, Alzheimers disease, showing the aluminum-related wavelength dispersive x-ray signal with
an increase in intensity as it passes through the apparent area of the nucleus. This image was used in Fig. 4 of the original article (reprinted with
permission, Science).
3. Subsequent studies
After the paper with Brody appeared, I now wanted
to use this approach to probe other disorders in which
NFTs appeared. This quickly led to an interest in
examining brain tissues from cases of amyotrophic
lateral sclerosis (ALS)/parkinsonism-dementia complex of Guam. ALS/parkinsonism-dementia complex of Guam is a unique neurodegenerative disorder
which appears with high prevalence among the native
Chamorro population living on the island of Guam in
the western Pacific. Clinically and neuropathologically, it has features of the three major age-related neurodegenerative diseases seen elsewhere in the world,
namely, ALS, Parkinsons disease and Alzheimers disease. Importantly, the brains of affected individuals
show large numbers of NFTs. I started to contact colleagues who had worked on the neuropathology of
ALS/parkinsonism-dementia complex of Guam to see
if I could obtain samples for x-ray microprobe analysis.
Everyone directed me to Dr. D. Carleton Gajdusek, a
Nobel laureate, then at the NIH, as the source of such
tissues. Dr. Gajdusek knew of my work and indicated
that he was anxious to establish a collaboration with
me. Soon a large box arrived in my laboratory at the
296
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
297
Fig. 4. Typical SEM-XES spectra obtained from the nuclear region of hippocampal neuron of a Guam control that is NFT-free (A) and a case of
parkinsonism-dementia complex of Guam (B). Note the prominent aluminum-related peak obtained from the parkinsonism-dementia complex of
Guam case which has extensive NFT-formation. Unstained frozen sections, hippocampus.
298
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
support of many phases of academic research by forprofit companies. However, this represents a Faustian
bargain and is accompanied by pressures to support hypotheses which underlie stock prices. Potential profits
or losses loom as not so subtle influences.
Another distracting factor had been the conflicting
data regarding mineral deposits in the cores of senile plaques, as reported by Candy and coworkers [1]
in Newcastle-upon-Tyne. These workers reported the
use of electron probe techniques similar to ourselves
and claimed seeing very high concentrations of aluminum and silicon in the cores of senile plaques of
cases of Alzheimers disease. These were interpreted
to be aluminosilicate deposits. We attempted to replicate these findings but were unable to identify such
deposits either by SEM-x-ray energy spectrometry or
by LAMMA [25]. Both techniques would have had
sufficient detection limits to identify these elements
had they been present, as reported by Candy. Subsequently, Landsberg and coworkers [13] used a focused 3 MeV ion beam nuclear microprobe to investigate senile plaques from Alzheimers disease cases and
failed to identify evidence of significant amounts of aluminum within their specimens. Unfortunately, when
this study was reported in Nature, the authors used their
negative data regarding senile plaques as a basis to argue that aluminum could not possibly play any role in
Alzheimers disease pathogenesis. As we subsequently
pointed out [7], their study dealt only with the trace
elemental content of senile plaques and contained no
data on the elemental content of neurofibrillary tangles.
We were particularly pleased to read the studies of
Murayama and coworkers [18] who published in 1999
on the association of aluminum and Alzheimers disease using a very different approach. They showed that
Morin staining of neurofibrillary tangles (Morin is a
histochemical method for identifying aluminum in tissues) could be abolished by pretreatment of the tissue
sections by the harsh treatment of boiling them in desferioximine, a known aluminum chelator. Further, they
showed that pretreatment of Alzheimers disease brain
sections with aluminum-containing solutions abolished
the immunostaining of the NFTs within the sections by
antibodies directed against hyperphosphorylated epitopes. When the sections were then treated with desferioxamine, the immunoreactivity returned, indicating
that aluminum binding favored these hyperphosphorylated sites. Finally, they showed that aluminum treatment caused aggregation of paired helical filaments and
that this was reversible by dephosphorylation of the
tangle preparation. This important study strongly sug-
gests that aluminum binding to the neurofibrillary tangle is part of the biology of Alzheimers disease and
not a postmortem artifact. It further demonstrates that
aluminum binds to phosphorylation sites, presumably
of tau, causing cross-linking stabilization of this constituent protein, mechanisms we hypothesized many
years ago. Finally, it provides an important independent confirmation of our work.
6. Final words
Finally, controversy has also surrounded a mistaken
impression that our data must be interpreted as implying an etiologic role for aluminum an Alzheimers disease, something we never claimed to be the case. It is
highly unlikely that aluminum represents an etiologic
agent for Alzheimers disease. However, based on our
studies, and those of many other workers, it has seemed
to me that aluminum does represent a constituent of
the neurofibrillary tangle and, as such, likely plays a
role in the pathogenetic process leading to the disease.
The concept of aluminum playing an active role in the
pathogenetic cascade does not lessen the potential importance of these findings since, with the exception of
infectious diseases, most approaches to treatment and
prevention of disease relates to an understanding of
pathogenetic mechanisms rather than etiologic ones.
Over the past 15 years there has been a dramatic
increase in our understanding of the genetic factors
which play a role in the development of Alzheimers
disease. Despite this considerable scientific progress,
it is highly unlikely that Alzheimers disease, an extremely common late life disorder, is wholly genetic
in its etiology. More likely, Alzheimers disease represents an interaction of both genetic (polygenic) and
environmental factors (with a healthy dose of aging
effects). This interaction of genes and environmental
factors is certainly true for some of the other common
late life diseases such as atherosclerosis leading to myocardial infarction and cancer. With this in mind, it
is important to recognize that our current approaches
to prevention of, for example, coronary atherosclerosis
primarily involve our understanding of relevant environmental risk factors (diet, exercise, smoking, etc.)
and their modification by the at-risk patient. This approach has certainly shown the effectiveness of this approach in this and other similar disorders of the elderly.
If we are to make progress in devising approaches to
effectively prevent Alzheimers disease we must look
for evidence related to relevant environmental factors.
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
[7]
[8]
[9]
[10]
[11]
Acknowledgements
[12]
[13]
[14]
[15]
[16]
[17]
[18]
References
[19]
[1]
[2]
[3]
[4]
[5]
[6]
[20]
[21]
[22]
[23]
299
300
D.P. Perl and S. Moalem / Aluminum and Alzheimers disease, a personal perspective after 25 years
[26]
301
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
302
normalities [32,33]. We analyzed and found insolubility for the filaments of Pick disease [25], progressive
supranuclear palsy [36], and Parkinson disease [7], but,
in contrast, cortical Lewy body disease [3] or Hirano
bodies (Galloway and Perry, unpublished observation)
were found soluble. In 1991, Sharon Greenberg found
a new way to isolate PHF (PHF- ), fractions that were
soluble and that subsequently were the standard preparation for biochemical studies on PHF [11].
As with the -only hypothesis, this led to great strides
in our understanding of PHF biochemistry, but at the
cost of discontinuing analysis of the fibers that form
NFT in vivo. NFT fibers vary from straight to PHF [26
28], extend the length of the neurons, and are insoluble [35]. In constrast, soluble PHF are homogenous
in form and soluble in SDS. Further, their isolation
requires the addition of a detergent to a non-filament
containing supernatant, suggesting soluble filaments
result from sarcosyl-induced assembly of present in
brain extracts. So while soluble has revealed much
of PHF biochemistry, they have not revealed why the
PHF in brain are insoluble and contain numerous components of the cytoskeleton beyond (e.g. [6]).
The first suggested biochemical mechanism for PHF
insolubility was crosslinking by glutamyl-lysine, bonds
catalyzed by transglutaminase [30]. In vitro, transglutaminase can crosslink or neurofilaments but in vivo
evidence such as detection of glutamyl-lysine has been
scant. Insolubility resulting from crosslinking is a critical event, making polymers resistant to removal, thus
inhibiting the normal proteolytic pathways [5]. Ubiquitination of PHF in vivo [19,24] and persistence in
neurons for years [2] suggest NFT are resistant to proteolytic removal. Glycation of PHF [33,39] discovered
in the mid-1990s provided a basis for insolubility [35]
and resistance to proteolytic removal, as did the subsequent findings of lipid peroxidation related modification [29] all suggesting reactive carbonyls play an
important role in PHF biochemistry. Aldehyde modifications also play an important role in PHF specific
epitopes, for while several antibodies raised to PHF
recognize phosphorylated more than normal , they
are phosphate independent. Establishing these epitopes
are induced by the reaction of carbonyls with phosphorylated but not non-phosphorylated may explain the
phosphorylation requirement for in PHF [18]. Interestingly, some of the antibodies raised to PHF, e.g.,
Alz50, only recognize intermediates in the reaction of
carbonyls with and not highly crosslinked [37].
Neurofilaments showed similar properties, with antibodies raised to NFT recognizing normal neurofila-
ments, but not , following carbonyl treatment of phosphorylated NFH [23,34]. In both and NFH, lysine
residues are critical for carbonyl reactivity and may
involve the lysine of the phosphorylation site of KSP
in NFH and KXSP in [37]. NFH modification by
carbonyls is not restricted to AD, but is also prominent
in neurofilaments of the major axons throughout the
body, with similar levels during aging suggesting a regulated process, with phosphorylation being the major
mediator [38].
Oxidative crosslinks are a property of NFT and oxidation can increase insolubility, but the two properties have not been quantitatively linked. As with all
inclusion fibers a rigorous accounting of composition
and posttranslational modifications remains to be performed. With the evolution of powerful analytical approaches (i.e., mass spectroscopy), it seems dissection of filament insolubility will be conquered in the
coming years. Hints can be drawn from analytical
approaches that revealed a major lipid component in
PHF [10], solubility in base [35] and precipitation of
soluble PHF- by the detergent sarcosyl [11]. Parallels can also be drawn from senile plaques where the
oxidative crosslink dityrosine increases insolubility in
vitro but yet is only detected in vivo at low levels [1,
4] (Perry and Chen, unpublished observations). There
too, amyloid is but one of numerous components of
senile plaques, a topic for another day.
PHF insolubility remains an important issue. The
contribution of phosphorylation, oxidation, deamidation, lipid, or yet to be identified factors will continue
to be an active area and a major focus of my laboratory for the foreseeable future. Balancing reductionist progress with natural complexity will continue to
confound modern biology as it has for over a half century. Added knowledge will surely tilt the balance to
understanding.
References
[1]
[2]
[3]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
303
304
305
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
306
Fig. 1. Histochemical detection of iron in AD (A) compared with control cases (B) show striking association of iron with neurofibrillary tangles
(arrowheads) and senile plaques (arrows) characteristic of the AD brain. (Scale bar = 200 m.) From Proc Natl Acad Sci USA 94:98669868,
1997. Copyright 1997 National Academy of Sciences, USA.
Fig. 2. Lesion-associated iron (see Fig. 1A) could be completely stripped with deferoxamine (A) but readily rebound to the same sites following
incubation with iron(III) citrate and iron(II) chloride (B). * indicates landmark blood vessel in adjacent section. (Scale bar = 100 m.) From
Proc Natl Acad Sci USA 94:98669868, 1997. Copyright 1997 National Academy of Sciences, USA.
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
Acknowledgments
[13]
I am extremely grateful for the efforts of students, postdoctoral fellows, and my many collaborators
throughout the world whose work I cite here. However, I am especially grateful to my long time collaborator, George Perry, whose collegiality, generosity, and
willingness to take risks with both people and ideas
have energized our decade-plus joint venture. Last, but
certainly not least, I am indebted to those that funded
our work and saw that we were not simply studying a
rusting wreck.
[17]
References
[18]
[1]
[2]
[3]
[14]
[15]
[16]
[19]
307
308
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
309
1. Introduction
Multiple lines of evidence suggest that modification
of tau is critical in A-induced neurofibrillary tangle
(NFT) formation and neuronal loss, although tau abnormalities do not appear to be the single causative factor
in AD. First, increasing deposition of tau is found in
the brain during aging and neuronal death is observed
in the same brain regions as NFTs; both neuronal death
and NFTs correlate with duration and severity of illness
in AD, although the amount of neuronal death is many
times more than the number of NFTs [24]. Second, a
tau mutation was recently identified as the causal factor
in frontotemporal dementia parkinsonism-17 (FTDP-
17), a dementing disease with NFT formation and neuronal loss [23,35,36,39,74,85]. The elucidation of mutated tau in FTDP-17 conclusively demonstrated that
tau dysfunction or abnormality alone could induce neurodegeneration characterized by NFTs and neuronal
death and leading to clinical dementia, similar to that
found in AD. Third, although the generally accepted
amyloid- hypothesis asserts that A is the initiator of
the neuronal death and NFT formation [29,70], A did
not cause neurotoxicity in primary neuronal cultures
from tau knockout mice [66].
Thus, although A may initiate the AD cascade, tau
must be a critical step, and the parallel pathways of
NFT formation and neuronal death occur only after tau
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
310
strates and participates in various cellular events including metabolism, signaling, and transcription [26].
Although GSK-3 is categorized as a proline-directed
kinase, most GSK-3 targets are phosphorylated by another kinase before they can be bound by activate GSK3. GSK-3 binds to the resulting phosphate at position P0 + 4 through the GSK-3 priming pocket and
transfers a phosphate to position P 0 [19,30]. This type
of phosphate transfer is a distinctive feature of GSK-3,
and is not seen in the other kinases.
2. Results
1. GSK-3 Phosphorylation of Tau
Although a number of kinases and phosphatases
regulate tau phosphorylation, GSK-3 is the main
tau kinase in vivo [5,9,38,45,46,53,54]. A 1988
report showed that GSK-3 (then called TPK1)
generated PHF-like epitopes on tau [40] Yang
et al. reported that GSK-3 could incorporate 4
moles of phosphate into each mole of tau, and that
GSK-3 slowed the electrophoretic mobility of tau
on SDS gels [91]. Ishiguro et al. demonstrated
TPK1/GSK-3-mediated phosphorylation of the
Tau-1 site [43], and reported phosphorylation at
Ser199, Thr231, Ser396, and Ser413 [43]. Using
monoclonal antibodies, Mandelkow et al. showed
that GSK-3 could also phosphorylate tau at
Ser202/Thr205, Ser396/Ser404, and Ser235 [55].
Hanger et al. confirmed that GSK-3 was able
to phosphorylate Ser396 [28]. These observations were extended using peptide-sequence analysis [91], polyclonal antibodies [41], 2D mapping [22,37], and nanoelectrospray mass spectrometry [67]. To date, GSK-3 has been
proven to phosphorylate 15 sites on tau: Ser46,
Thr50, Thr175, Thr181, Ser199, Ser202, Thr205,
Thr212, Thr217, Thr231, Ser235, Ser396,
Ser400, Ser404, and Ser413. Ser400 and Ser413
are the only non-proline-directed sites.
2. A-Induced GSK-3 Activation Causes Hyperphosphorylation of Tau
Because GSK-3 is involved in hyperphosphorylation of tau, GSK-3 may be a critical factor
for A-induced neuronal death and NFT formation, and may be activated either directly or indirectly by A. Therefore, focusing on the role
of GSK-3 may reveal a mechanism of neurodegeneration in AD and a therapeutic target. To
test whether GSK-3 is activated by A, we in-
311
312
Fig. 1. Mechanism of A-induced NFT formation, synapse loss, and neuron loss.
313
Aging brain
Aging
NFT formation
Cognitive Impairment
Alzheimer s disease
A
Aging
NFT formation
Acceler ated
br ain aging
Dementia
Fig. 3. Development of AD requires brain aging, and FTDP17 mutation or A accelerates the aging process, leading to dementia.
defense systems, and underlying all of the detrimental pathways activated by A, including formation of NFTs and neuronal loss in AD.
7. GSK-3 Acceleration of Aging in Animal Models of AD
The lack of an animal model that includes both
NFT formation and neuronal loss impedes efforts
to evaluate the effects of GSK-3 inhibition in AD.
Importantly, the Braak and Braak study shows
that NFT formation in the entorhinal cortex precedes A deposition, whereas NFTs appear in
the limbic and neocortical areas only after A
deposition [7] (Fig. 2). Based on their analysis,
NFT formation in entorhinal cortex may develop
during the course of normal brain aging, and only
spread into the limbic and neocortical areas in the
disease state of AD. That is, the chronology of the
pathological changes appears to start with NFTs
developing in the entorhinal cortex in the absence
of A, and to continue with A deposition, which
314
3. Discussion
Accumulating data show that GSK-3 phosphorylates several substrates, including tau, and participates
in multiple cellular events. For example, GSK-3
phosphorylation of kinesin inhibits kinesin binding
with cargo proteins, thereby leading to synaptic dysfunction resulting from the impairment of protein trafficking. As tau disassociates from microtubules and
is hyperphosphorylated, the microtubule becomes unstable. This impairment of the protein trafficking system may also lead to synaptic dysfunction, and synaptic dysfunction leads to synaptic loss, which can cause
neuronal death.
GSK-3 can also phosphorylate transcription factors
and inhibit protein synthesis, leading to apoptosis and
decreased LTP and memory formation. GSK-3 phosphorylation of HSF1 inhibits the expression of HSP
that is a defense against cellular stress. Thus, GSK-3
reduces the cellular defense system. As a result, cells
become more vulnerable to stressors, such as A and
oxidative stress. Therefore, although the activation of
GSK-3 itself is not toxic, its actions within cells can
lead to neuronal death during aging and especially in
AD.
Using both in vitro and animal models, we have
shown that GSK-3 is essential to multiple pathways
in the pathogenesis of AD. NFT formation may reflect
the extent of brain aging, GSK-3 activation may occur
during brain aging, and A may accelerate the brain
aging and increase the GSK-3 activation, which may
increase A deposition. Therefore, GSK-3 inhibition
is a potential therapy for AD, because it may inhibit
both A generation and A-induced pathophysiological events in AD models.
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
A.S. Alberts et al., Recombinant cyclic AMP response element binding protein (CREB) phosphorylated on Ser-133 is
transcriptionally active upon its introduction into fibroblast
nuclei, J Biol Chem 269(10) (1994), 76237630.
G. Alvarez et al., Lithium protects cultured neurons against
beta-amyloid-induced neurodegeneration, FEBS Lett 453(3)
(1999), 260264.
G.N. Bijur, R.E. Davis and R.S. Jope, Rapid activation of
heat shock factor-1 DNA binding by H2O2 and modulation by
glutathione in human neuroblastoma and Alzheimers disease
cybrid cells, Brain Res Mol Brain Res 71(1) (1999), 6977.
G.N. Bijur, P. De Sarno and R.S. Jope, Glycogen synthase
kinase-3beta facilitates staurosporine- and heat shock-induced
apoptosis. Protection by lithium, J Biol Chem 275(11) (2000),
75837590.
M.L. Billingsley and R.L. Kincaid, Regulated phosphorylation and dephosphorylation of tau protein: effects on microtubule interaction, intracellular trafficking and neurodegeneration, Biochem J 323(3) (1997), 577591.
J.A. Blendy et al., Targeting of the CREB gene leads to upregulation of a novel CREB mRNA isoform, Embo J 15(5)
(1996), 10981106.
H. Braak and E. Braak, Diagnostic criteria for neuropathologic assessment of Alzheimers disease, Neurobiol Aging
18(4 Suppl) (1997), S8588.
P.K. Brindle and M.R. Montminy, The CREB family of transcription activators, Curr Opin Genet Dev 2(2) (1992), 199
204.
L.a.A.D. Buee, Tau phosphorylation, in: Functional Neurobiology of Aging, P.R.H.a.C.V. Mobbs, ed., Academic Press,
2001, pp. 315332.
B.P. Bullock and J.F. Habener, Phosphorylation of the cAMP
response element binding protein CREB by cAMP-dependent
protein kinase A and glycogen synthase kinase-3 alters DNAbinding affinity, conformation, and increases net charge, Biochemistry 37(11) (1998), 37953809.
B. Chu et al., Sequential phosphorylation by mitogen-activated
protein kinase and glycogen synthase kinase 3 represses transcriptional activation by heat shock factor-1, J Biol Chem
271(48) (1996), 3084730857.
S.R. DMello, R. Anelli and P. Calissano, Lithium induces
apoptosis in immature cerebellar granule cells but promotes
survival of mature neurons, Exp Cell Res 211(2) (1994), 332
338.
G.W. Davis, C.M. Schuster and C.S. Goodman, Genetic dissection of structural and functional components of synaptic
plasticity. III. CREB is necessary for presynaptic functional
plasticity, Neuron 17(4) (1996), 669679.
K. Deisseroth, H. Bito and R.W. Tsien, Signaling from synapse
to nucleus: postsynaptic CREB phosphorylation during multiple forms of hippocampal synaptic plasticity, Neuron 16(1)
(1996), 89101.
B. Dermaut et al., A novel presenilin 1 mutation associated
with Picks disease but not beta-amyloid plaques, Ann Neurol
55(5) (2004), 617626.
J.A. Diehl et al., Glycogen synthase kinase-3beta regulates
cyclin D1 proteolysis and subcellular localization, Genes Dev
12(22) (1998), 34993511.
G. Evin et al., Alternative transcripts of presenilin-1 associated with frontotemporal dementia, Neuroreport 13(6) (2002),
917921.
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
315
316
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
[90]
[91]
317
D. Tang-Wai et al., Familial frontotemporal dementia associated with a novel presenilin-1 mutation, Dement Geriatr Cogn
Disord 14(1) (2002), 1321.
Y. Tatebayashi et al., Tau filament formation and associative
memory deficit in aged mice expressing mutant (R406W) human tau, Proc Natl Acad Sci USA 99(21) (2002), 13896
13901.
J.C. van Swieten et al., Phenotypic variation in frontotemporal
dementia and parkinsonism linked to chromosome 17, Dement
Geriatr Cogn Disord 17(4) (2004), 261264.
C.a.A.R. Volonte, Lithium chloride promotes short-term survival of PC12 cells after serum and NGF deprivation, Lithium
4 (1993), 211219.
G. Waeber and J.F. Habener, Nuclear translocation and
DNA recognition signals colocalized within the bZIP domain
of cyclic adenosine 3,5-monophosphate response elementbinding protein CREB, Mol Endocrinol 5(10) (1991), 1431
1438.
B.E. Wilson, E. Mochon and L.M. Boxer, Induction of bcl-2
expression by phosphorylated CREB proteins during B-cell
activation and rescue from apoptosis, Mol Cell Biol 16(10)
(1996), 55465556.
J.R. Woodgett, Molecular cloning and expression of glycogen
synthase kinase-3/factor A, Embo J 9(8) (1990), 24312438.
J. Xing, D.D. Ginty and M.E. Greenberg, Coupling of the
RAS-MAPK pathway to gene activation by RSK2, a growth
factor-regulated CREB kinase, Science 273(5277) (1996),
959963.
S.D. Yang et al., Protein kinase FA/GSK-3 phosphorylates
tau on Ser235-Pro and Ser404-Pro that are abnormally phosphorylated in Alzheimers disease brain, J Neurochem 61(5)
(1993), 17421747.
319
Netherlands Institute for Brain Research, Meibergdreef 33, 1105 AZ Amsterdam, The Netherlands
Department of Functional Genomics, Center for Neurogenomics and Cognitive Research (CNCR), Vrije
Universiteit and VU Medical Center, de Boelelaan 1085, 1081HV Amsterdam, The Netherlands
b
Abstract. Neuronal homeostasis requires a constant balance between biosynthetic and catabolic processes. Eukaryotic cells primarily use two distinct
mechanisms for degradation: the proteasome and autophagy of aggregates by
the lysosomes. We focused on the ubiquitin-proteasome system (UPS) and
discovered a frameshift protein for ubiquitin (UBB +1 ), that accumulates in the
neuritic plaques and tangles in patients with Alzheimers disease (AD). UBB +1 ,
unable to tag proteins to be degraded, has been shown to be a substrate for ubiquitination and subsequent proteasomal degradation. If UBB +1 is accumulated,
it inhibits the proteasome, which may result in neuronal death. We showed
that UBB+1 is also present in other tauopathies (e.g. Picks disease) and in
several polyglutamine diseases, but remarkably not in synucleinopathies (e.g.
Parkinsons disease). Accumulation of UBB +1 -being a reporter for proteasomal dysfunctioning- thus differentiates between these conformational diseases.
The accumulation of UBB +1 causes a dysfunctional UPS in these multifactorial
neurodegenerative diseases. Novel transgenic mouse models and large-scale
expression profiling and functional analyses of enzymes of the UPS compounds enabling us to identify the targets
of the UPS in these conformational diseases may now pave the way for intervention and treatment of AD.
Keywords: Conformational diseases, molecular misreading, polyglutamine diseases, synucleinopathies, tauopathies, vasopressin
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
320
F.W. van Leeuwen et al. / Frameshift proteins in Alzheimers disease and in other conformational disorders
ular chaperones (e.g. heat shock proteins) and numerous components of the ubiquitin-proteasome system
(UPS). These include E3 ligases such as parkin and
CHIP, the latter forming a link between the chaperone
and proteasome system [5]. In addition CDC 48 a
chaperone required for substrate recruitment and segregation and E4 compounds the latter involved in
shipping and targetting of ubiquitinated proteins to the
19S regulator and 20S proteasomal subunits are also
present in the inclusions. For these compounds an escort pathway has been proposed [6]. The presence
of these factors suggests that these insoluble proteins
are misfolded and have been targeted for degradation,
but instead of being properly refolded or proteolytically degraded, they accumulate in insoluble protein
deposits [7]. The coexistence of heat shock proteins
and UPS compounds is not surprising, since one of the
fundamental tasks of the UPS is to degrade damaged
or abnormal proteins and to protect cells during stress
responses. In addition, adaptation of proteasome composition is possible [8]. When the capacity of the UPS
is exceeded [9], autophagins, molecular determinants
of autophagic vacuole formation, are recruited to aggresomes, pericentriolar cytoplasmic inclusion bodies,
essential for the elimination of aggregates and subsequent lysosomal degradation [10]. Many reviews on
the UPS [2,11] and autophagy [12] in relation to neurodegeneration have been published (e.g. [13,14]). Apparently evolution has provided cells with many ways
to protect themselves against cytotoxic insults associated with the accumulation of proteinaceous aggregates [15].
F.W. van Leeuwen et al. / Frameshift proteins in Alzheimers disease and in other conformational disorders
321
Fig. 2. UBB+1 expression in several tauopathies, polyglutamine disease and a non-neuronal conformational disease.
Frameshift ubiquitin (UBB+1 ) is present in the hallmarks of tauopathies in AD (A), Picks disease (B,C), progressive supranuclear palsy (PSP;
D,E) and argyrophilic grain disease in polyglutamine diseases: Huntingtons disease (G) and spinocerebellar ataxia type-3 (SCA-3)(H). UBB+1
is also present in inclusions of non-neuronal cells such as in Mallory bodies of hepatocytes of patients with liver cirrhosis (I) [30].
In A: insert shows UBB+1 in neurofibrillary tangles and neuropil threads (). In B and C Pick bodies are present in pyramidal cells (B) and
in granular cells (C). In PSP both neurofibrillary tangles (D) and glial cells (, E) are labeled. In F the grains are seen. In HD (G) intranuclear
inclusions (n = 1, 2, 3) are seen, in SCA-3, both the nucleus and cytoplasm are UBB+1 positive. A = 50-m-thick vibratome sections and BI
are 6 m paraffin sections. Bar in AF and HI = 50 m, G = 25 m. Inserts are blow-ups.
thetized in non-neuronal cells, due to molecular misreading of the transgene. Subsequently, frameshifted
ubiquitin (UBB+1 ) was found in inclusions of various
non-neurological diseases and suggests a similar mech-
322
F.W. van Leeuwen et al. / Frameshift proteins in Alzheimers disease and in other conformational disorders
F.W. van Leeuwen et al. / Frameshift proteins in Alzheimers disease and in other conformational disorders
pUC
ori
PCMV IE
pUC
ori
PCMV IE
mRFP
HSV TK
poly A
HSV TK
poly A
pDFF130
4.9 kb
Kan /
r
Neo
SV40 ori
PSV40
P
SV40
poly A
f1
ori
EGFP
pDFF131
4.9 kb
UBB
+1
Kan /
Neo r
323
SV40 ori
PSV40
P
SV40
poly A
f1
ori
UBB+1
Fig. 3. Tools to track cellular proteasomal dysfunction: UBB+1 fusion proteins and usable for screening RNAi libraries.
Schematic presentation of plasmids pDFF130 and pDFF131 encoding, respectively, a mRFP-UBB+1 red fluorescent and EGFP-UBB+1 green
fluorescent proteins fused to UBB+1 . 293T cells were transfected with either pDFF130 or pDFF131 and analyzed after 48 hrs. UBB+1 [16]
was cloned by PCR in the HindIII and SalI sites of pEGFP-C1 [16], Clontech or mRFP-C1 [16], generating a fusion protein with an N-terminal
fluorochrome and C-terminal aberrant ubiquitin. Plasmids were tested in 293T human embryonic kidney cells. 5 microgram of plasmid DNA
was transfected by calcium phosphate precipitation in 6-well plates. Images were made after 48 hrs using a Nikon Digital Net100 camera on a
Nikon Eclipse TS100 microscope under simultaneous phase-contrast and fluorescent illumination.
Other possible mechanisms to cope with insoluble proteins are posttranslational modifications
by ubiquitin paralogues (sumoylation and neddylation) but also phosphorylation and oxidation
(e.g. [53]). The relation of these modifications to
inclusion formation in the various conformational
diseases is currently investigated by proteomics.
(DUBS) by screening RNAi libraries might result in DUBS promoting deubiquitination of ubiquitinated UBB+1 (Fig. 3) [55]. It was shown
that polyubiquitinated UBB +1 chains are refractory to disassembly by DUBS and potently inhibit
the degradation of a polyubiquitinated substrate
by purified 26S proteasomes [26]. RNA silencing techniques to neutralize UPS transcripts or viral technology to compensate for a lack of them
are the candidates for therapy as has been shown
in polyglutamine diseases such as spinocerebellar
ataxia-1 [46,56].
Acknowledgements
The authors are indebted to Drs. R.A.I de Vos
(Enschede, The Netherlands), E.R. Brunt (Groningen,
324
F.W. van Leeuwen et al. / Frameshift proteins in Alzheimers disease and in other conformational disorders
The Netherlands), M.L.C. Maat (Leiden, The Netherlands), S. French (Los Angeles, USA) and the Netherlands Brain Bank (coordinator R. Ravid) for sharing postmortem human brain and liver tissues, and to
Drs.O. Pach and W. Verweij for their secretarial support. Financial support was obtained from the Society for Progressive Supranuclear Palsy (#440-04), Jan
Dekker Stichting and dr. Ludgardine Bouwman Stichting, #04-22), Internationale Stichting Alzheimer Onderzoek (#04507/04830 and #01601 01504) and the
Hersenstichting Nederland (#12F04.1 and 13F05.11).
[15]
[16]
[17]
[18]
[19]
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
F.W. van Leeuwen et al. / Frameshift proteins in Alzheimers disease and in other conformational disorders
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
325
Genetics
329
Department of Pharmacology, New York University School of Medicine, New York, New York, USA
Department of Pathology, New York University School of Medicine, New York, New York, USA
c
Department of Psychiatry, New York University School of Medicine, New York, New York, USA
d
Nathan Kline Institute, Orangeburg, New York, USA
b
Keywords: Alzheimers disease, hereditary cerebral hemorrhage with amyloidosis, Dutch type (HCHWA-D), cerebral amyloid
angiopathy (CAA), amyloid -protein precursor (APP), amyloid (A)
Corresponding author: Efrat Levy, Center for Dementia Research, Nathan Kline Institute, 140 Old Orangeburg Road, Orangeburg, NY 10962, USA. Tel.: +1 845 398 5540; Fax: +1 845 398
5422; E-mail: elevy@nki.rfmh.org.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
330
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
patients with hereditary cerebral hemorrhage with amyloidosis, Icelandic type (HCHWA-I) [25]. The amyloid
deposition in cerebral arteries and arterioles in these
patients leads to recurrent hemorrhagic strokes causing
serious brain damage and eventually fatal stroke before
the age of 40 years [48]. The leptomeningeal amyloid
was identified as a variant of cystatin C [7], also known
as trace [55], a cysteine protease inhibitor [3,7]. A
mutation in the cystatin C gene in HCHWA-I patients
results in a L68Q substitution [25,38,69]. In the same
year, 1983, Prusiner et al. [98] purified scrapie prion as
the protein that forms amyloid aggregates in the brain
of hamsters.
The same approach of extraction of the amyloid protein from leptomeninges was utilized to isolate amyloid from the brain of AD and Downs syndrome patients. The initial amino-terminal sequence analysis
yielded a 28 amino acids peptide called amyloid
protein (A) [40]. A year later A was purified and
characterized as the major amyloid protein of plaque
cores from brain parenchyma of AD and Downs syndrome patients [76], indicating a common origin for
the amyloids of plaque core and of congophilic angiopathy. The length of the plaque amyloid protein was
reported to be 4243 residues [76]. Additional studies clarified that the complete length of leptomeningeal
vascular A is 3940 residues [95]. Finding that the
same protein forms the amyloid in brain parenchyma
and vasculature in Downs syndrome and AD patients
suggested that the defect in AD is localized on chromosome 21 [39,76]. Immunohistochemical and biochemical studies demonstrated that A composed of 42
amino acids is the major molecular species deposited
in brain parenchyma and A species ending at position 40 are predominantly deposited in the blood vessel walls [17]. However, species ending at position 42
are also present, and sometimes are the sole deposited
peptide species in CAA [123].
Isolation of the amyloid protein enabled cloning of
the gene revealing that A is part of a larger amyloid
protein precursor (APP) [43,64,66,100,116]. The
APP gene located on chromosome 21, consists of 19
exons that are alternatively spliced into several mRNA
forms, four of which, encoding 695, 717, 751, and 770
amino acids, contain the A-encoding sequences.
Diseases that involve A deposition seem to be heterogeneous in etiology and clinical presentation. Although most cases of AD appear sporadic, a small number of cases occur in families with autosomal dominant form of inheritance of the disease. Epidemiological studies showed autosomal dominant inheritance
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
331
Fig. 1. APP pathogenic substitutions. The amino acid sequence of A (uppercase) and flanking regions (lowercase), the sites of secretase
cleavages, the amino acid substitutions found in pedigrees with familial Alzheimers disease (FAD) that produce Alzheimers disease phenotypes,
and those that are primarily associated with CAA phenotypes.
the mutated alleles. Moreover, both glutamine and glutamic acid were found at position 22 of A in amyloid
fibrils derived from leptomeningeal vascular walls of
HCHWA-D patients [96] (Fig. 1).
Following the discovery of the HCHWA-D mutation a search for mutations in the APP gene lead to
the identification of linkage to chromosome 21 in a
few early onset FAD pedigrees and of several APP
missense mutations within or flanking the A region
(Fig. 1). Although the APP mutations account for
less than 0.1% of all AD cases, they carry complete
penetrance leading to AD between the fourth to seventh decades of life [115]. The presence of a mutation
is important in determining the rate and age at which
amyloid fibrils are deposited in a patient. Moreover,
the different mutation sites in the APP gene influence
the clinicopathological manifestation of the resulting
disease. Point mutations in genes encoding amyloid
precursor proteins have been detected in different types
of amyloidosis, and prevalent thought is that the consequent amino acid substitution alters the conformation of the proteins and/or their proteolysis promoting aggregation. Therefore, it was suggested that substitutions located amino- or carboxyl-terminal to A
may affect either -secretase or -secretase cleavage
of APP. Although the mutations found in several FAD
pedigrees were thought to have a quantitative or qualitative effect on A production, the only mutation that
proved to affect the amount of the secreted peptide
is the K670N/M671L double mutation located aminoterminally to A, found in a Swedish kindred [15,22,
85]. Using cultured cells transfected with APP expression constructs, it was shown that cells expressing
mutated APP secrete higher levels of A compared
to cells expressing the normal sequence [13,51,104,
107]. The substitutions found proximal to the carboxylterminus of A at codon 717 [19,41,86,89,139]seem to
332
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
333
334
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
Acknowledgments
Supported by National Institute of Neurological Disorders and Stroke grant NS42029, the National Institute
on Aging grants AG16837, and AG05891, American
Heart Association grant 0040102N.
References
[1]
[2]
[3]
[4]
[5]
[6]
C.R. Abraham, D.J. Selkoe and H. Potter, Immunochemical identification of the serine protease inhibitor
1-antichymotrypsin in the brain amyloid deposits of
Alzheimers disease, Cell 52 (1988), 487501.
E. Bakker, C. Van Broeckhoven, J. Haan, E. Voorhoeve, W.
Van Hul, E. Levy, I. Lieberburg, M.D. Carman, G.J. van
Ommen, B. Frangione and R.A.C. Roos, DNA diagnosis for
hereditary cerebral hemorrhage with amyloidosis, Am J Hum
Gen 49 (1991), 518521.
A.J. Barrett, M.E. Davies and A.O. Grubb, The place of
human -trace (cystatin C) amongst the cysteine proteinase
inhibitors, Biochem Biophys Res Commun 120 (1984), 631
636.
H.G. Bernstein, S. Bruszis, D. Schmidt, B. Wiederanders and
A. Dorn, Immunodetection of cathepsin D in neuritic plaques
found in brains of patients with dementia of Alzheimer type,
J Hirnforsch 30 (1989), 613618.
H.G. Bernstein, H. Kirschke, B. Wiederanders, D. Schmidt
and A. Rinne, Antigenic expression of cathepsin B in aged
human brain, Brain Res Bull 24 (1990), 543549.
K. Beyer, J.I. Lao, M. Gomez, N. Riutort, P. Latorre, J.L.
Mate and A. Ariza, Alzheimers disease and the cystatin C
gene polymorphism: an association study, Neurosci Lett 315
(2001), 1720.
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
335
336
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
U. Finckh, H. von Der Kammer, J. Velden, T. Michel, B.
Andresen, A. Deng, J. Zhang, T. Muller-Thomsen, K. Zuchowski, G. Menzer, U. Mann, A. Papassotiropoulos, R.
Heun, J. Zurdel, F. Holst, L. Benussi, G. Stoppe, J. Reiss,
A.R. Miserez, H.B. Staehelin, G.W. Rebeck, B.T. Hyman, G.
Binetti, C. Hock, J.H. Growdon and R.M. Nitsch, Genetic association of a cystatin C gene polymorphism with late-onset
Alzheimer disease, Arch Neurol 57 (2000), 15791583.
P.E. Fraser, J.T. Nguyen, H. Inouye, W.K. Surewicz, D.J.
Selkoe, M.B. Podlisny and D.A. Kirschner, Fibril formation by primate, rodent, and Dutch-hemorrhagic analogues
of Alzheimer amyloid -protein, Biochemistry 31 (1992),
1071610723.
D. Games, D. Adams, R. Alessandrini, R. Barbour, P.
Berthelette, C. Blackwell, T. Carr, J. Clemens, T. Donaldson, F. Gillespie, T. Guido, S. Hagopian, K. Johnson-Wood,
K. Khan, M. Lee, P. Leibovitz, I. Lieburburg, S. Little, E.
Masliah, L. McConlogue, M. Montoya-Zavala, L. Mucke,
L. Paganini, E. Penniman, M. Power, D. Schenk, P. Seubert, B. Snyder, F. Soriano, H. Tan, J. Vitale, S. Wadsworth,
B. Wolozin and J. Zhao, Alzheimer-type neuropathology in
transgenic mice overexpressing V717F -amyloid precursor
protein, Nature 373 (1995), 523527.
J. Ghiso, O. Jensson and B. Frangione, Amyloid fibrils in
hereditary cerebral hemorrhage with amyloidosis of Icelandic type is a variant of trace basic protein (cystatin C),
Proc Natl Acad Sci USA 83 (1986), 29742978.
G.G. Glenner and C.W. Wong, Alzheimers disease and
Downs syndrome: sharing of a unique cerebrovascular amyloid fibril protein, Biochem Biophys Res Commun 122 (1984),
11311135.
G.G. Glenner and C.W. Wong, Alzheimers disease: initial
report of the purification and characterization of a novel cerebrovascular amyloid protein, Biochem Biophys Res Commun
120 (1984), 885890.
A. Goate, M.C. Chartier-Harlin, M. Mullan, J. Brown, F.
Crawford, L. Fidani, L. Giuffra, A. Haynes, N. Irving, L.
James, R. Mant, P. Newton, K. Rooke, P. Roques, C. Talbot,
M. Pericak-Vance, A. Roses, R. Williamson, M. Rossor, M.
Owen and J. Hardy, Segregation of a missense mutation in
the amyloid precursor protein gene with familial Alzheimers
disease, Nature 349 (1991), 704706.
K.A. Goddard, J.M. Olson, H. Payami, M. Van Der Voet, H.
Kuivaniemi and G. Tromp, Evidence of linkage and association on chromosome 20 for late-onset Alzheimer disease,
Neurogenetics 5 (2004), 121128.
D. Goldgaber, M.I. Lerman, O.W. McBride, U. Saffiotti and
D.C. Gajdusek, Characterization and chromosomal localization of a cDNA encoding brain amyloid of Alzheimers disease, Science 235 (1987), 877878.
P.A. Gollin, R.N. Kalaria, P. Eikelenboom, A. Rozemuller
and G. Perry, 1-antitrypsin and 1-antichymotrypsin are
in the lesions of Alzheimers disease, Neuroreport 3 (1992),
201203.
T.J. Grabowski, H.S. Cho, J.P. Vonsattel, G.W. Rebeck and
S.M. Greenberg, Novel amyloid precursor protein mutation
in an Iowa family with dementia and severe cerebral amyloid
angiopathy, Ann Neurol 49 (2001), 697705.
S.M. Greenberg, G.W. Rebeck, J.P. Vonsattel, T. Gomez-Isla
and B.T. Hyman, Apolipoprotein E 4 and cerebral hemorrhage associated with amyloid angiopathy, Ann Neurol 38
(1995), 254259.
S.M. Greenberg, J.P. Vonsattel, A.Z. Segal, R.I. Chiu, A.E.
Clatworthy, A. Liao, B.T. Hyman and G.W. Rebeck, Asso-
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
[62]
[63]
[64]
[65]
[66]
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[74]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
[87]
[88]
337
338
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]
[102]
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
ease and kuru plaque amyloid in Creutzfeldt-Jakob disease,
Brain Res 541 (1991), 163166.
S. Naruse, S. Igarashi, H. Kobayashi, K. Aoki, T. Inuzuka,
K. Kaneko, T. Shimizu, K. Iihara, T. Kojima, T. Miyatake
and S. Teuji, Mis-sense mutation ValIle in exon 17 of amyloid precursor protein gene in Japanese familial Alzheimers
disease, Lancet 337 (1991), 978979.
J.A. Nicoll, C. Burnett, S. Love, D.I. Graham, D. Dewar,
J.W. Ironside, J. Stewart and H.V. Vinters, High frequency
of apolipoprotein E 2 allele in hemorrhage due to cerebral
amyloid angiopathy, Ann Neurol 41 (1997), 716721.
C. Nilsberth, A. Westlind-Danielsson, C.B. Eckman, M.M.
Condron, K. Axelman, C. Forsell, C. Stenh, J. Luthman, D.B.
Teplow, S.G. Younkin, J. Naslund and L. Lannfelt, The Arctic APP mutation (E693G) causes Alzheimers disease by
enhanced A protofibril formation, Nat Neurosci 4 (2001),
887893.
R.A. Nixon, A.M. Cataldo, P.A. Paskevich, D.J. Hamilton, T.R. Wheelock and L. Kanaley-Andrews, The lysosomal system in neurons. Involvement at multiple stages of
Alzheimers disease pathogenesis, Ann N Y Acad Sci 674
(1992), 6588.
D. Nochlin, T.D. Bird, E.J. Nemens, M.J. Ball and S.M.
Sumi, Amyloid angiopathy in a Volga German family with
Alzheimers disease and a presenilin-2 mutation (N141I),
Ann Neurol 43 (1998), 131135.
J.M. Olson, K.A. Goddard and D.M. Dudek, A second locus
for very-late-onset Alzheimer disease: a genome scan reveals
linkage to 20p and epistasis between 20p and the amyloid
precursor protein region, Am J Hum Genet 71 (2002), 154
161.
F. Prelli, E. Castano, G.G. Glenner and B. Frangione,
Differences between vascular and plaque core amyloid in
Alzheimers disease, J Neurochem 51 (1988), 648651.
F. Prelli, E. Levy, S.G. van Duinen, G.T. Bots, W. Luyendijk
and B. Frangione, Expression of a normal and variant
Alzheimers -protein gene in amyloid of hereditary cerebral hemorrhage, Dutch type: DNA and protein diagnostic
assays, Biochem Biophys Res Commun 170 (1990), 301307.
D.L. Price and S.S. Sisodia, Mutant genes in familial
Alzheimers disease and transgenic models, Annu Rev Neurosci 21 (1998), 479505.
S.B. Prusiner, M.P. McKinley, K.A. Bowman, D.C. Bolton,
P.E. Bendheim, D.F. Groth and G.G. Glenner, Scrapie prions
aggregate to form amyloid-like birefringent rods, Cell 35
(1983), 349358.
G.W. Rebeck, S.D. Harr, D.K. Strickland and B.T.
Hyman, Multiple, diverse senile plaque-associated proteins are ligands of an apolipoprotein E receptor, the
2-macroglobulin receptor/low-density-lipoprotein receptorrelated protein, Ann Neurol 37 (1995), 211217.
N.K. Robakis, N. Ramakrishna, G. Wolfe and H.M. Wisniewski, Molecular cloning and characterization of a cDNA
encoding the cerebrovascular and the neuritic plaque amyloid
peptides, Proc Natl Acad Sci USA 84 (1987), 41904194.
G. Rossi, G. Giaccone, R. Maletta, M. Morbin, R. Capobianco, M. Mangieri, A.R. Giovagnoli, A. Bizzi, C. Tomaino,
M. Perri, M. Di Natale, F. Tagliavini, O. Bugiani and A.C.
Bruni, A family with Alzheimer disease and strokes associated with A713T mutation of the APP gene, Neurology 63
(2004), 910912.
A.M. Saunders, W.J. Strittmatter, D. Schmechel, P.H.
George-Hyslop, M.A. Pericak-Vance, S.H. Joo, B.L. Rosi,
J.F. Gusella, D.R. Crapper-MacLachlan, M.J. Alberts, C.
[103]
[104]
[105]
[106]
[107]
[108]
[109]
[110]
[111]
[112]
[113]
Hulette, B. Crain, D. Goldgaber and A.D. Roses, Association of apolipoprotein E allele 4 with late-onset familial and
sporadic Alzheimers Disease, Neurology 43 (1993), 1467
1472.
G.D. Schellenberg, T.D. Bird, E.M. Wijsman, D.K. Moore,
M. Boehnke, E.M. Bryant, T.H. Lampe, D. Nochlin, S.M.
Sumi, S.S. Deeb, K. Beyreuther and G.M. Martin, Absence of linkage of chromosome 21q21 markers to familial
Alzheimers disease, Science 241 (1988), 15071510.
P. Seubert, C. Vigo-Pelfrey, F. Esch, M. Lee, H. Dovey, D.
Davis, S. Sinha, M. Schlossmacher, J. Whaley, C. Swindlehurst, R. McCormack, R. Wolfert, D.J. Selkoe, I. Lieberburg and D. Schenk, Isolation and quantification of soluble
Alzheimers -peptide from biological fluids, Nature 359
(1992), 325327.
R. Sherrington, E.I. Rogaev, Y. Liang, E.A. Rogaeva, G.
Levesque, M. Ikeda, H. Chi, C. Lin, G. Li, K. Holman, T.
Tsuda, L. Mar, J.F. Foncin, A. Bruni, M. Montesi, S. Sorbi,
I. Rainero, L. Pinessi, L. Nee, I. Chumakov, D. Pollen, A.
Brookes, P. Sanseau, R.J. Polinsky, W. Wasco, H.A.R. Da
Silva, J.L. Haines, M.A. Pericak-Vance, R.E. Tanzi, A.D.
Roses, P.E. Fraser, J.M. Rommens and P. St George-Hyslop,
Cloning of a gene bearing missense mutations in early-onset
familial Alzheimers disease, Nature 375 (1995), 754760.
T. Shimizu, H. Fukuda, S. Murayama, N. Izumiyama and T.
Shirasawa, Isoaspartate formation at position 23 of amyloid
peptide enhanced fibril formation and deposited onto senile plaques and vascular amyloids in Alzheimers disease, J
Neurosci Res 70 (2002), 451461.
M. Shoji, T.E. Golde, J. Ghiso, T.T. Cheung, S. Estus, L.M.
Shaffer, X.D. Cai, D.M. McKay, R. Tintner, B. Frangione and
S.G. Younkin, Production of the Alzheimer amyloid protein by normal proteolytic processing, Science 258 (1992),
126129.
A.D. Snow, J. Willmer and R. Kisilevsky, Sulfated glycosaminoglycans: a common constituent of all amyloids?,
Lab Invest 56 (1987), 120123.
C. Soto, M.S. Kindy, M. Baumann and B. Frangione, Inhibition of Alzheimers amyloidosis by peptides that prevent
-sheet conformation, Biochem Biophys Res Commun 226
(1996), 672680.
P.H. St George-Hyslop, R.E. Tanzi, R.J. Polinsky, J.L.
Haines, L. Nee, P.C. Watkins, R.H. Myers, R.G. Feldman, D.
Pollen, D. Drachman, J. Growdon, A. Bruni, J.-F. Foncin, D.
Salmon, P. Frommelt, L. Amaducci, S. Sorbi, S. Piacentini,
G.D. Stewart, W.J. Hobbs, P.M. Conneally, J.F. Gusella, The
genetic defect causing familial Alzheimers disease maps on
chromosome 21, Science 235 (1987), 885890.
W.J. Strittmatter, A.M. Saunders, D. Schmechel, M.
Pericak-Vance, J. Enghild, G.S. Salvesen and A.D. Roses,
Apolipoprotein E: high-avidity binding to -amyloid and
increased frequency of type 4 allele in late-onset familial
Alzheimers Disease, Proc Natl Acad Sci USA 90 (1993),
19771981.
C. Sturchler-Pierrat, D. Abramowski, M. Duke, K.H. Wiederhold, C. Mistl, S. Rothacher, B. Ledermann, K. Burki, P.
Frey, P.A. Paganetti, C. Waridel, M.E. Calhoun, M. Jucker,
A. Probst, M. Staufenbiel and B. Sommer, Two amyloid
precursor protein transgenic mouse models with Alzheimer
disease-like pathology, Proc Natl Acad Sci USA 94 (1997),
1328713292.
N. Suzuki, T.T. Cheung, X.D. Cai, A. Odaka, L. Otvos, Jr.,
C. Eckman, T.E. Golde and S.G. Younkin, An increased
percentage of long amyloid protein secreted by familial
E. Levy et al. / Studies on the first described Alzheimers disease amyloid mutant, the Dutch variant
[114]
[115]
[116]
[117]
[118]
[119]
[120]
[121]
[122]
[123]
[124]
[125]
[126]
[127]
[128]
[129]
[130]
[131]
[132]
[133]
[134]
[135]
[136]
[137]
[138]
[139]
[140]
339
341
Keywords: Familial Alzheimers disease, Amyloid -protein precursor, Amyloid , gene, mutation, pathogenesis
1. Introduction
In 1991 little was known about the pathobiology of
Alzheimers disease. Earlier studies had demonstrated
that plaques contain amyloid (A) and that neurofibrillary tangles were composed of paired-helical filaments of hyperphosphorylated tau [7,11,21]. However,
it was unclear whether either of these inclusions was
causative, largely because A plaques were believed
to be common in non-demented elderly and NFT were
known to occur in many neurodegenerative diseases.
Thus neither inclusion appeared to be specific for AD.
Early studies suggested that NFT showed a better cor-
relation with dementia than plaques and thus it was argued they were more likely to be the cause of disease.
A major impediment to the molecular dissection of AD
was the absence of cellular or animal models of disease.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
342
A. Goate / Segregation of a missense mutation in the amyloid -protein precursor gene with familial Alzheimers disease
ics only began to make analysis of these families feasible in the late 1980s. The Human Genome Project
led to major methodological advances including the development of genetic and physical maps of the human
genome, methods for linkage analysis and PCR. Initial studies of FAD focused on chromosome 21 for two
reasons, all individuals with Down syndrome (trisomy
of chromosome 21) develop AD by middle age and A
had been shown to be derived from a larger precursor protein, the amyloid protein precursor (APP)
encoded by a gene on chromosome 21 [10,17,34,48].
Linkage was first reported between DNA markers on
chromosome 21 and FAD in 1987 [43]. However, some
groups failed to replicate these results in other family
series [32,37]. When APP was shown to be encoded
by a gene on chromosome 21 it was clearly a very
strong candidate gene. However, the APP gene was
quickly excluded because recombination events were
observed between the APP gene and AD in several
families [49,50]. At this time FAD was assumed to be
a genetically homogeneous disorder and therefore the
observation of recombinants in one family excluded the
gene in all families. With the benefit of hindsight this
appears to be a very naive viewpoint. Fifteen years on,
non-allelic genetic heterogeneity in neurodegenerative
diseases is common [41].
3. Familial Alzheimers disease is genetically
heterogeneous
A turning point in AD genetics was the multicenter investigation headed by Peter Hyslop and John
Hardy [42]. This paper analyzed data from many families and came to the conclusion that FAD exhibited
non-allelic genetic heterogeneity i.e. that some families were linked to a locus on chromosome 21 but that
many families were not. Furthermore, there was more
than one linkage signal on chromosome 21 raising the
possibility of more than one gene on chromosome 21
leading to AD. This observation meant that a gene on
chromosome 21 could only be excluded if the family
showed evidence of linkage to chromosome 21 and that
data from families should be analyzed individually, not
pooled with other families, unless the families show
linkage individually.
4. A Missense mutation in the APP gene causes
FAD
After this paper, and two other papers describing
linkage to the APP gene and a mutation in APP in
A. Goate / Segregation of a missense mutation in the amyloid -protein precursor gene with familial Alzheimers disease
343
344
A. Goate / Segregation of a missense mutation in the amyloid -protein precursor gene with familial Alzheimers disease
TM
APP
AE AICD
K
G
GQ N
RN
NL
G
F
AA T L
IMVI
TM
11
E-secretase
16
40 42
49
J-secretase
D-secretase
Fig. 1. Location of disease causing mutations in APP a type 1 transmembrane protein. FAD mutations in APP are located within and flanking
the A sequence and close to the proteolytic cleavage sites. FAD mutations are shown in grey above the normal sequence of the protein. Numbers
indicate the amino acid position within the A peptide. The location of the major proteolytic cleavage sites in APP are indicated by arrows
below the sequence.
AE PP
40/42
S3-like
A
A
672
770
713
TM
E -secretase
D-secretase
TM
sAEPPD
C83/CTFD
sAEPPE
TM
C99/CTF E
J-secretase
J-secretase
p3
TM
CTFJ/AICD
CTF
D-secretase pathway
A
A
CTF
/AICD
CTFJ/AICD
E-secretase pathway
Fig. 2. APP is proteolytically cleaved via two pathways. In most cells APP is cleaved by -secretase followed by -secretase. In neurons the
predominant pathway involves sequential cleavage by -secretase and -secretase.
FAD mutations appear to alter APP processing to produce more A, increase the propensity of A to form
protofibrils or alter the ratio of the A species. Most
early onset FAD kindreds appear to carry a mutation in
either the substrate or the enzyme that generates A.
It is unclear how many other FAD genes there may be
because most large FAD kindreds carry a mutation in
one of the three known genes.
A major focus of current genetic research is the
identification of genetic risk factors for late onset AD
(LOAD). Currently the only known genetic risk factor
for LOAD is APOE4 [4,45]. However, only 50% of
AD cases carry one or more copies of the E4 allele suggesting that there must be other risk factors. Genetic
A. Goate / Segregation of a missense mutation in the amyloid -protein precursor gene with familial Alzheimers disease
345
References
[1]
346
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
A. Goate / Segregation of a missense mutation in the amyloid -protein precursor gene with familial Alzheimers disease
Go, A. Mahoney, T. Beaty, M.D. Fallin, D. Avramopoulos, G.A. Chase, M.F. Folstein, M.G. McInnis, S.S. Bassett,
K.J. Doheny, E.W. Pugh and R.E. Tanzi, Results of a highresolution genome screen of 437 Alzheimers disease families,
Hum Mol Genet 12 (2003), 2332.
M.C. Chartier-Harlin, F. Crawford, H. Houlden, A. Warren, D.
Hughes, L. Fidani, A. Goate, M. Rossor, P. Roques, J. Hardy
et al., Early-onset Alzheimers disease caused by mutations at
codon 717 of the beta-amyloid precursor protein gene, Nature
353 (1991), 844846.
M. Citron, T. Oltersdorf, C. Haass, L. McConlogue, A.Y.
Hung, P. Seubert, C. Vigo-Pelfrey, I. Lieberburg and D.J.
Selkoe, Mutation of the beta-amyloid precursor protein in familial Alzheimers disease increases beta-protein production,
Nature 360 (1992), 672674.
E.H. Corder, A.M. Saunders, W.J. Strittmatter, D.E.
Schmechel, P.C. Gaskell, G.W. Small, A.D. Roses, J.L. Haines
and M.A. Pericak-Vance, Gene dose of apolipoprotein E type 4
allele and the risk of Alzheimers disease in late onset families,
Science 261 (1993), 921923.
J.D. Fryer, K. Simmons, M. Parsadanian, K.R. Bales, S.M.
Paul, P.M. Sullivan and D.M. Holtzman, Human apolipoprotein E4 alters the amyloid-beta 40:42 ratio and promotes the
formation of cerebral amyloid angiopathy in an amyloid precursor protein transgenic model, J Neurosci 25 (2005), 2803
2810.
D. Games, D. Adams, R. Alessandrini, R. Barbour, P.
Berthelette, C. Blackwell, T. Carr, J. Clemens, T. Donaldson,
F. Gillespie et al., Alzheimer-type neuropathology in transgenic mice overexpressing V717F beta-amyloid precursor protein, Nature 373 (1995), 523527.
G.G. Glenner and C.W. Wong, Alzheimers disease: initial
report of the purification and characterization of a novel cerebrovascular amyloid protein, Biochem Biophys Res Commun
120 (1984), 885890.
A. Goate, M.C. Chartier-Harlin, M. Mullan, J. Brown, F.
Crawford, L. Fidani, L. Giuffra, A. Haynes, N. Irving, L.
James et al., Segregation of a missense mutation in the amyloid precursor protein gene with familial Alzheimers disease,
Nature 349 (1991), 704706.
A.M. Goate, A.R. Haynes, M.J. Owen, M. Farrall, L.A. James,
L.Y. Lai, M.J. Mullan, P. Roques, M.N. Rossor, R. Williamson
et al., Predisposing locus for Alzheimers disease on chromosome 21, Lancet 1 (1989), 352355.
D. Goldgaber, M.I. Lerman, W.O. McBride, U. Saffiotti and
D.C. Gajdusek, Isolation, characterization, and chromosomal
localization of human brain cDNA clones coding for the precursor of the amyloid of brain in Alzheimers disease, Downs
syndrome and aging, J Neural Transm Suppl 24 (1987), 2328.
I. Grundke-Iqbal, K. Iqbal, M. Quinlan, Y.C. Tung, M.S. Zaidi
and H.M. Wisniewski, Microtubule-associated protein tau. A
component of Alzheimer paired helical filaments, J Biol Chem
261 (1986), 60846089.
S. Hecimovic, J. Wang, G. Dolios, M. Martinez, R. Wang and
A.M. Goate, Mutations in APP have independent effects on
Abeta and CTFgamma generation, Neurobiol Dis 17 (2004),
205218.
L. Hendriks, C.M. van Duijn, P. Cras, M. Cruts, W. Van Hul, F.
van Harskamp, A. Warren, M.G. McInnis, S.E. Antonarakis,
J.J. Martin et al., Presenile dementia and cerebral haemorrhage linked to a mutation at codon 692 of the beta-amyloid
precursor protein gene, Nat Genet 1 (1992), 218221.
M.C. Herzig, D.T. Winkler, P. Burgermeister, M. Pfeifer,
E. Kohler, S.D. Schmidt, S. Danner, D. Abramowski, C.
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
Sturchler-Pierrat, K. Burki, S.G. van Duinen, M.L. MaatSchieman, M. Staufenbiel, P.M. Mathews and M. Jucker,
Abeta is targeted to the vasculature in a mouse model of hereditary cerebral hemorrhage with amyloidosis, Nat Neurosci 7
(2004), 954960.
D.M. Holtzman, K.R. Bales, T. Tenkova, A.M. Fagan, M.
Parsadanian, L.J. Sartorius, B. Mackey, J. Olney, D. McKeel, D. Wozniak and S.M. Paul, Apolipoprotein E isoformdependent amyloid deposition and neuritic degeneration in a
mouse model of Alzheimers disease, Proc Natl Acad Sci USA
97 (2000), 28922897.
K. Hsiao, Transgenic mice expressing Alzheimer amyloid precursor proteins, Exp Gerontol 33 (1998), 883889.
J. Kang, H.G. Lemaire, A. Unterbeck, J.M. Salbaum, C.L.
Masters, K.H. Grzeschik, G. Multhaup, K. Beyreuther and B.
Muller-Hill, The precursor of Alzheimers disease amyloid A4
protein resembles a cell-surface receptor, Nature 325 (1987),
733736.
E. Levy, M.D. Carman, I.J. Fernandez-Madrid, M.D. Power,
I. Lieberburg, S.G. van Duinen, G.T. Bots, W. Luyendijk and
B. Frangione, Mutation of the Alzheimers disease amyloid
gene in hereditary cerebral hemorrhage, Dutch type, Science
248 (1990), 11241126.
E. Levy-Lahad, E.M. Wijsman, E. Nemens, L. Anderson, K.A.
Goddard, J.L. Weber, T.D. Bird and G.D. Schellenberg, A
familial Alzheimers disease locus on chromosome 1, Science
269 (1995), 970973.
K. Lowenberg and R. Waggoner, Familial organic psychosis
(Alzheimers type), Arch. Neurol. Psychiatr 31 (1934), 737.
C.L. Masters, G. Simms, N.A. Weinman, G. Multhaup, B.L.
McDonald and K. Beyreuther, Amyloid plaque core protein in
Alzheimer disease and Down syndrome, Proc Natl Acad Sci
USA 82 (1985), 42454249.
M. Mullan, H. Houlden, M. Windelspecht, L. Fidani, C. Lombardi, P. Diaz, M. Rossor, R. Crook, J. Hardy, K. Duff et
al., A locus for familial early-onset Alzheimers disease on
the long arm of chromosome 14, proximal to the alpha 1antichymotrypsin gene, Nat Genet 2 (1992), 340342.
J. Murrell, M. Farlow, B. Ghetti and M.D. Benson, A mutation
in the amyloid precursor protein associated with hereditary
Alzheimers disease, Science 254 (1991), 9799.
A. Myers, P. Holmans, H. Marshall, J. Kwon, D. Meyer, D.
Ramic, S. Shears, J. Booth, F.W. DeVrieze, R. Crook, M.
Hamshere, R. Abraham, N. Tunstall, F. Rice, S. Carty, S. Lillystone, P. Kehoe, V. Rudrasingham, L. Jones, S. Lovestone, J.
Perez-Tur, J. Williams, M.J. Owen, J. Hardy and A.M. Goate,
Susceptibility locus for Alzheimers disease on chromosome
10, Science 290 (2000), 23042305.
A. Myers, F. Wavrant De-Vrieze, P. Holmans, M. Hamshere,
R. Crook, D. Compton, H. Marshall, D. Meyer, S. Shears, J.
Booth, D. Ramic, H. Knowles, J.C. Morris, N. Williams, N.
Norton, R. Abraham, P. Kehoe, H. Williams, V. Rudrasingham, F. Rice, P. Giles, N. Tunstall, L. Jones, S. Lovestone, J.
Williams, M.J. Owen, J. Hardy and A. Goate, Full genome
screen for Alzheimer disease: stage II analysis, Am J Med
Genet 114 (2002), 235244.
R.L. Neve and N.K. Robakis, Alzheimers disease: a reexamination of the amyloid hypothesis, Trends Neurosci 21
(1998), 1519.
C. Nilsberth, A. Westlind-Danielsson, C.B. Eckman, M.M.
Condron, K. Axelman, C. Forsell, C. Stenh, J. Luthman, D.B.
Teplow, S.G. Younkin, J. Naslund and L. Lannfelt, The Arctic APP mutation (E693G) causes Alzheimers disease by en-
A. Goate / Segregation of a missense mutation in the amyloid -protein precursor gene with familial Alzheimers disease
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
347
349
To Carleton Gajdusek.
We wish we know more about the work that lead
to the first paper describing Alzheimers disease (AD)
that was published 100 years ago. We wish we know
more about the people who were involved in that work
and the circumstances that lead Alois Alzheimer to the
realization that the patient had indeed a novel disease.
The aim of my story is to describe events that took
place 20 years ago and that may be of interest to a few
people later.
The following is the story of my work on the cloning
of the amyloid gene. The facts are correct. At the very
least they are as I remember them.
When I decided to clone the amyloid gene I did not
know that there were some twenty groups around the
research world that desperately tried to do the same. If I
knew that I would have never started the project because
I hate competitions. Competition in most projects in
science means that the problem will be solved sooner
or later. I, on the other hand, am always looking for
novel ideas and new things to do, and always tried to
open new doors instead of jumping on a band wagon.
I was so ignorant about the disease that I did not
know how to spell the name Alzheimer. I had to look
at the papers of other researchers to make sure that my
spelling was correct.
After the cloning, I was invited to numerous national
and international meetings on AD. I never refused and
during the next several years I went to every one. These
meeting provided me with a great education. The irony
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
350
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
NCI. That was fine with me. I told him that I would be
coming as an apprentice. I didnt need any "pay" in the
form of papers. I told him that I always work hard and
that the knowledge I gain will be my pay.
Early 1985.
I plunged into Mishas projects spending most of my
waking hours in the lab of Dr. Saffiotti. Dr. Saffiotti
was very supportive and a real gentleman. We worked
on chemical cancerogenesis trying to find oncogenes
that were responsible for the transformation of keratinocytes treated with cancer inducing chemicals. I
enjoyed working with Misha very much and I learned
a lot. I learned many new methods including making
various cDNA and genomic libraries and gene cloning.
I know that he too was very happy with me because
I was a quick learner, worked hard, generated a lot of
data, and had great respect for Misha.
The idea
Time passed very quickly and in the fall of 1985 I
finally felt that I have to begin working on a project that
Carleton would be interested in. Carleton at that time,
as well as now, was very interested in brain amyloid.
He saw a lot of similarities between amyloid found in
scrapie, Kuru, Creutzfeldt-Jakob disease on one hand
and AD on the other hand.
Colin Masters, who spent many years in Carletons lab, and his colleagues in Germany in Konrad
Beyreuters lab just published a paper in PNAS with
a sequence of the A4 peptide that was almost identical to the sequence of amyloid beta protein (A) that
was published 1984 by George G. Glenner and his associate C.W. Wong. The Americans purified the peptide from leptomeninges of AD and Downs syndrome
(DS) brain [1,2]. Colin and company purified the peptide from the plaques of AD and DS brains [3]. The
sequence of a peptide called A4 by a German group
was almost identical to the sequence of the A peptide
of George Glenner, except for minor differences and
the fact that the sequence of A4 was longer. In fact,
Colin and colleagues would not have been able to understand the protein sequencing results if not for the
published peptide sequence of Glenner. Plaque amyloid is composed of a mixture of peptides of identical
sequence but of different length because of the ragged
N- and C-termini. Therefore, it was practically impossible to decipher the sequencing signals of peptide
mixture without knowing the A peptide sequence of
Glenner.
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
351
Conception
In the fall of 1985 I went to Carleton and proposed
to clone the Alzheimers amyloid gene the gene that
encodes the A protein that Glenner and Wong purified
from the AD brain and published in 1984. Carleton
supported me. The paper of Masters and his colleagues
in Germany was just published in PNAS and Carleton
was very excited by it [3]. He later told me that at that
time he did not believe that I would succeed. But, as
it happened before me to others, Carleton never prohibited people in his lab from doing what they thought
was important. He might have discouraged them if he
did not believe in their ideas, but he never stopped them
from trying.
First attempts
It was known that amyloid was detected in extracellular plaques and in intraneuronal neurofibrillary tangles (NFTs). I discussed the project with Carleton and
352
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
oxyinosine in ambiguous positions. Because deoxyinosine is a small molecule it does not interfere during hybridization with sequences of genes containing
any of the four nucleotides at the position opposite to
deoxyinosine.
Another problem in cloning was the existence of sequences in many proteins that were similar to the sequence of the peptide or to one of it regions. I understood that it was important to find a unique region in
the sequence of A. At that time very few researchers
knew how to compare sequences and BLAST was not
at their fingertips as it is now.
Nina Goldgaber, who was my wife at that time, was
working for a computer firm that serviced NIH scientists at Fort Detrick. One of her duties was analysis of
protein and DNA sequences. I asked Nina to compare
the sequence of A with the database of known proteins and protein sequences predicted from the cloned
genes in the GeneBank. The purpose was to identify
regions of A that had the least similarities to known
sequences. I wanted to use the sequence of the unique
region of A for generating a probe with deoxyinosine in every ambiguous position. Nina compared the
sequences and I saw that there was indeed a region
of A that was similar to regions found in many proteins. However, there was another region of A that
had no significant homology to known sequences in the
GeneBank. These two steps the use of deoxyinosine
and the identification of a unique region of A (plus a
bit of luck) were crucial in the successful cloning of
the amyloid gene.
I told Misha about Ninas results, showed him the
unique region of A and the sequence of the probe
with deoxyinosine. Misha had no objections and I
ordered the probe in the fall of 1985. There were
only two companies in the United States that made
deoxyinosine at that time. I send the request to one
of these companies. Surprisingly, I did not receive my
probe for several months. When I called to find why
the probe was not made, I was told that there was an
explosion in the room next to the one where they were
making deoxyinosine and the hallway and all adjacent
rooms were sealed for investigation. But they told
me that the investigation was almost over. After my
call they opened the room, made deoxyinosine, and
synthesized my probe.
I continued to work with Misha on his projects in
Saffiottis lab. It was an exiting time. I spent days and
sometimes nights in the lab. I remember that one day in
1986 I came out of the lab during the daytime and was
surprised to see it was already spring. I was working
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
Birth
It was already June of 1986. Mishas project on
chemical cancerogenesis was finished. Unfortunately,
we did not find the oncogene. Misha was leaving the
NCI. He had a good offer from the Dental Institute
in Bethesda he would get his own lab with several
positions and a good research budget. Finally, I had
time to work on my own project on the amyloid gene.
I had several cDNA and genomic libraries to screen
with my deoxyinosine containing probe. Some of these
libraries were purchased and some I made myself. At
first I screened my best libraries. Each time, after the
first round of screening I had some weak positive signals. I picked the clones from the positive areas and
re-screened them. No signals. They were false positives. Finally, in the second half of the summer, only
one library was left unscreened. It was a library from a
commercial source with very poor characteristics and
short inserts. After so many failed attempts I did not
believe that screening of this library would bring anything different. But I had nothing else to do. And I
hate to miss chances. Even if I had only one chance in
a million, I would rather try it than later feel that I had
this chance, however small it was, and did not take it.
So, I screened the last library with my deoxyinosine
containing probe and, as before, I got several weak
353
354
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
Postpartum
Carleton told me that we should quickly find a place
where we can present this discovery. Carleton attended
a FESN meeting in the Pierre Hotel in New York in
the fall of 1986 and already talked about this work to
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
355
356
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
357
Fig. 5. Dmitry Goldgaber with Benno Muller-Hill (right) and J. Kang (next to Benno) at the University of Cologne, 1987.
358
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
Fig. 6. Dmitry Goldgaber with Allen D. Roses (center) and Don E. Schmechel (undated).
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
Next step
For a long period of time, A was believed to be a
pathological product of processing of APP. However,
in the early 90s, it was shown that A was present in
serum and in CSF of people who did not have AD.
These results changed the prevailing view because they
showed that A was a normal product of APP processing. By that time it was known that A is cytotoxic and self-aggregates easily forming oligomers and
amyloid. Because A was a product of normal cellular events the organism must have had a mechanism of
neutralizing and disposing of this toxic self-aggregating
product. So, I switched from thinking about the processes of generation of A to the ideas of its disposal
and neutralization. I reasoned that this mechanism
must work well in healthy individuals, otherwise we
would all have AD pathology, and that the pathological changes observed in AD might develop because of
the failure of this mechanism. At the molecular level
this mechanism must involve an interaction of A with
other molecules. Such interaction may neutralize cytotoxicity of A and prevent amyloid formation. My
sequestration hypothesis was published in 1993 and we
began the search for A sequestering molecules. We
found that indeed there was a major protein in CSF that
formed complex with A. Surprisingly, it was a well
known transporter protein transthyretin (TTR). TTR
transports thyroid hormone T4 as well as retinol A.
TTR is produced primarily in liver and choroids plexus.
TTR is a well known nutritional marker and a negative
response protein. It is down regulated by inflammation. We found TTR- A complexes in human CSF
and showed that interaction of TTR with A prevented
formation of amyloid. In addition, TTR neutralized
A toxicity. A number of studies directly or indirectly
supported the sequestration hypothesis. For example,
the levels of TTR is low in CSF of patients with AD.
The levels of TTR in CSF inversely correlated with
amount of neuritic plaques in hippocampus. Recently,
a dramatic increase of TTR was detected in transgenic
mice that overproduced A but did not develop massive
amyloid depositions. Infusion of anti TTR antibody
into the brains of these mice resulted in an increase of
amyloid, phosphorylation of tau, and caused neuronal
cell loss. It seems that TTR protects these transgenic
mice from the detrimental effects of A. Reversely,
conditions that lead to a decrease of amyloid burden
in model systems were accompanied by an increase in
the amounts of TTR and TTR- A complexes. Epidemiological data pointed to the role of non-steroidal
359
References
[1]
G.G. Glenner and C.W. Wong, Alzheimers disease. Initial report of the purification and characterization of a novel cerebrovascular amyloid protein, Biochem. Biophys. Res. Commun. 120 (1984), 885890.
[2] G.G. Glenner and C.W. Wong, Alzheimers disease and
Downs syndrome Sharing of a unique cerebrovascular amyloid fibril protein, Biochem. Biophy Res Commun. 122 (1984),
11311135.
[3] C.L. Masters, G. Simms, N.A. Weinman, G. Multhaup, B.L.
McDonald and K. Beyreuther, Amyloid plaque core protein in
Alzheimer disease and Down syndrome, Proc. Nat. Acad. Sci.
USA 82 (1985), 42454249.
[4] Y. Takahashi, K. Kato, Y. Hayashizaki, T. Wakabayashi, E.
Ohtsula, S. Matsuki, M. Ikehara and K. Matsubara, Molecular
cloning of the human cholecystokinin gene by use of a synthetic probe containing deoxyinosine, Proc. Nat. Acad. Sci.
USA 82 (1985), 19311935.
[5] D. Goldgaber, M.I. Lerman, W.O. McBride, U. Saffiotti and
D.C. Gajdusek, Isolation and characterization of human brain
cDNA clones coding for the precursor of the amyloid of brain
in Alzheimers disease, Downs syndrome and aging, J. Neural
Transmission 28 (1987), Suppl. 24.
[6] G. Ferry, Journey to the centre of Dementia, New Scientist
(November 20, 1986), 20.
[7] I. Amato, Alzheimers Disease: Scientists report advances,
Science News (November 22, 1986), 327.
[8] J. Kang, H.G. Lemaire, A. Unterbeck, J.M. Salbaum, C.L.
Masters, K.H. Grzeschik, G. Multhaup, K. Beyreuther and B.
Muller-Hill, The precursor of Alzheimers disease amyloid A4
protein resembles a cell surface receptor, Nature 325 (1987),
733736.
[9] P.H. St.George-Hyslop, R.E. Tanzi, R.J. Polinsky, J.L. Haines,
L. Nee, P.C. Watkins, R.H. Myers, R.G. Feldman, D. Pollen,
D. Drachman, J. Crowdon, A. Bruni, J.F. Foncini, D. Salmon,
P. Frommelt, L. Amaducci, S. Sorbi, S. Piacentinni, G.D.
Stewart, W.J. Hobbs, P.M. Conneally and J.F. Gusella, The
genetic defect causing familial Alzheimers disease maps to
chromosome 21, Science 235 (1987), 885890.
[10] N.K. Robakis, H.M. Wisniewski, E.C. Jenkins, E.A. Devinegage, G.E. Houck, X.L. Yao. N. Ramakrishna, G. Wolfe, W.P.
Silverman and W.T. Brown, Chromosome 21q21 sublocalization of gene encoding beta-amyloid peptide in cerebral vessels and neuritic (senile) plaques of people with Alzheimers
disease and Down syndrome, Lancet 1-8529 (1987), 384385.
360
[11]
D. Goldgaber / My story: The discovery and mapping to chromosome 21 of the Alzheimer amyloid gene
[13]
361
1. Introduction
At the time of the APOE/AD discovery in 1992,
the Joseph and Kathleen Bryan Alzheimers Disease
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
362
2. The linkage
In 1988, after the ADRC was founded, my first nonADRC research funding in AD [and my last!] was an
NIA LEAD [Leadership and Excellenxe in Alzheimers
Disease] Award for seven years. Shortly after, we had
increased the rate of ascertainment, examination, and
DNA sampling of patients in our Clinical Core and their
families, our statistical geneticist reported significant
linkage in late-onset AD multiplex families on chromosome 19q13 by a newly applied method of multipoint
analysis [6,11]. It is now hard to believe the level of
skepticism in 1991 when barely a decade later we can
perform genome wide screening based on variants in
the sequenced Human Genome. We also had identified
a large single family with 12 siblings, several of whom
were diagnosed with early-onset autosomal dominant
AD, and several more family members who were at risk.
We determined chromosome 21 linkage, then gave the
information and DNA samples to a collaborating St.
Marys Hospital group [12]. In addition, we generated
a relatively huge family resource with early onset autosomal dominant AD that we transferred to Dr. Gerry
Schellenbergs laboratory where they were searching
for loci other than chromosome 21 [13]. Both families
were included on the first reports of APP717 mutations (of the two families [12]) and what turned out
to be chromosome 14-linked presenilin mutations (the
largest family of the four [13]). The fractious nature of
the AD genetic field was illustrated early when the initial submission of the APP717 paper eliminated any
mention of the collaboration and had to be corrected
in proof. The second paper never acknowledged the
very large familiy and collaboration.
We were actively participants in the early chromosome 19 Gene Mapping Consortium by concentrating
on the then-laborious task of discovering, sequencing
and testing candidate genes at or near 19q13. It also
helped that our major research had been in myotonic
muscular dystrophy which had also mapped to chromosome 19. The first gene localized to chromosome
19 had been apolipoprotein E which everyone knew
had nothing to do with either myotonic dystrophy or
AD.
363
APOE2/3 individuals had very late age-of-onset perhaps indicating that APOE2 was a longevity gene. Dr.
Saunders never went back to the syntenic mouse laboratory and has been committed and productive. She
was the lead author on the initial genetic association
with sporadic AD and continued the subsequent experiments and later headed the APOE Team in GSK that
led to the clinical trial problem for glucose metabolism
and apoptosis research [34].
4. The follow-up
The first presentation of the familial APOE data was
in November 1992 at the Society for Neurosciences
ADRC meeting [15]. Three papers were prepared. The
first described the amyloid experiments leading to the
association of APOE4 to familial AD and was published in the Proc Nat Acad Sci USA in 1993 [1]. The
third paper prepared was published a month later by
Science [3]. The critical paper describing the sporadic
AD association was published eleven months after submission to Neurology [2]. (No press releases accompanied the first three papers, and the data were duly
ignored by the AD community.)
At the Academy of Neurology meeting in New York
City in April 1993, a ten minute presentation on the
sporadic AD data [at the time in press] was followed
by a seriously heated attack on the data during the discussion [16]. A reporter for the Wall Street Journal,
Michael Waldholz, was in attendance. Every good reporter likes controversy so he followed the presentation up by calling folks in the AD research world during
May 1993. He did not call me but others told me of the
calls.
My life changed on June 7, 1993, when I awoke on
a Monday morning to a telephone call from a post-doc
that my picture was on the front page of the Wall Street
Journal [17]. Subsequent public meetings went from
vicious to nasty, with prominent colleagues explicitly
stating that they could not replicate the association [but
later quietly retracted due to lab errors!]. However, a
series of published letters in Lancet and other medical journals in which multiple investigators in Europe
and Japan confirmed the APOE4 association with relatively small series of AD patients using their hospital
laboratory APOE genotyping.
364
5. Towards a treatment
Space and decorum does not permit my view of
academic science from 19931997. When my seven
year NIA grant ended, so did my academic career.
Only grant applications that implicated amyloid as a
causative factor were fundable at the NIA study sections. Our work in apoE expression differences in
neurons from mice and humans went unnoticed [7,
8,1824]. Moving to a leadership position in GlaxoWellcome provided me the opportunity to apply genomics, proteomics and genetics in ways which were
unimaginable in academia. This work continued into
GSK [merger of GW and SmithKlineBeecham] and
has led to one of several AD programs active within
the company some novel, some based on amyloid
involvement, and one based on the differences found
in protein expression between brain tissue expressing
neuronal human apoE4 and tissue expressing neuronal
apoE3 [25,26].
Positron emission tomography data developed first
by Dr. Eric Reiman in Arizona, and confirmed by Dr.
Gary Small at UCLA, clearly demonstrated that patients who carry the APOE4 allele either homozygous
or heterozygous metabolize glucose [FDG] at a lower
rate than patients with APOE3 and APOE2 alleles [27,
28].
A series of proteomic experiments in which brain
from APOE knock-out mice and APOE knock-out
mice transfected with human genomic APOE isoformspecific genes [with human-like neuronal apoE expression] identified a small number of genes with decreased
or increased protein expression [25,26]. In additional
these experiments are supported by a wealth of physiological supporting data, such as the use of thermography as a heat surrogate for measuring the rate of glucose
metabolism in synaptosomes. A group of these genes
clearly identified by proteomic screening supported decreased glucose utilization associated with apoE4, and
these data were supported by thermography data.
In a series of in vitro thermography, glucose utilization and glucose utilization experiments with compounds known to affect glucose utilization through
several mechanisms, we generated data with several
lead compounds that increased glucose utilization in
APOE4 animals to the level found in APOE3 animals. These compounds are at various stages in the
pipeline [26].
The compounds were Perioxisome Proliferatoractivated Receptor Activators. The GW experiments
concentrated on PPAR agonists, including one under
[12]
References
[13]
[1]
[2]
[3]
[4]
[5]
[6]
W. Strittmatter, A. Saunders, D. Schmechel, M. PericakVance, J. Enghild, G. Salvesen and A. Roses, Apolipoprotein E: high-avidity binding to beta-amyloid and increased frequency of type 4 allele in late-onset familial Alzheimer disease, Proceedings of the National Academy of Sciences of the
United States of America 90 (2004), 19771981.
A. Saunders, W. Strittmatter, D. Schmechel, P. GeorgeHyslop, M. Pericak-Vance, S. Joo, B. Rosi, J. Gusella, D.
Crapper-MacLachlan, M. Alberts, C. Hulette, B. Crain, D.
Goldgaber and A. Roses, Association of apolipoprotein E allele epsilon 4 with late-onset familial and sporadic Alzheimers
disease, Neurology 43 (1993), 14671472.
E. Corder, A. Saunders, W. Strittmatter, D. Schmechel, P.
Gaskell, G. Small, A. Roses, J. Haines and M. Pericak-Vance,
Gene dose of apolipoprotein E type 4 allele and the risk of
Alzheimers disease in late onset families, Science 261 (1993),
921923.
Heyman, W. Wilkinson, B. Hurwitz, D. Schmechel, A. Sigmon, T. Weinberg, M. Helms and M. Swift, Alzheimers disease: genetic aspects and associated clinical disorders, Annals
of Neurology 14 (1983), 507515.
A. Roses, M. Pericak-Vance, L. Yamaoka, C. Haynes, M.
Speer, P. Gaskell, W. Hung, C. Clark, A. Heyman, J. Trofatter,
N. Earl, J. Gilbert, J. Lee, M. Alberts, D. Dawson, R. Bartlett,
T. Siddique, J. Vance and P. Conneally, Linkage studies in familial Alzheimers disease, Progress in Clinical & Biological
Research 317 (1989), 201215.
C. Hulette, K. Welsh-Bohmer, B. Crain, M. Szymanski, N.
Sinclaire and A. Roses, Rapid brain autopsy. The Joseph and
Kathleen Bryan Alzheimers Disease Research Center experience, Archives of Pathology & Laboratory Medicine 121
(1997), 615618.
[7]
[8]
[9]
[10]
[11]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
365
366
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
367
My entry into Alzheimers disease genetics and really into human genetics began with a casual hallway
conversation with Tom Bird, a colleague in Neurology
at the University of Washington. He showed me some
dementia pedigrees, both large and small, and wondered if I was interested in working on a linkage study
of Alzheimers disease. The year was 1984, an exciting
time in human genetics. James Gusella had just used
linkage analysis and newly developed DNA markers to
map Huntingtons disease to the short arm of chromosome 4 [9]. Even though at this time, only 2030% of
human chromosomes had been mapped, DNA sequencing was a tedious manual process, PCR had not been
invented, and the word genome was rarely used in
the same phrase with human, the optimistic view was
that the Huntingtons disease gene would be identified
in 23 years, no problem. So why not do the same for
thing with Alzheimers disease?
I was trained as a biochemist, and recognized the
power of genetics to find molecules responsible for bi-
ologic function. However, even though I had used genetic tools throughout my career, just like using antibodies does not make you an immunologist, I was not
a geneticist. My real interest in Toms proposition was
not out of an interest in genetics, but rather I figured
that if I helped map and clone the Alzheimers disease
gene, I would have a leg-up on working on the protein.
After all, this was only going to take a few years, so
I started to work with Tom. We were both highly enthusiastic about the project for different reasons. I was
enthusiastic out of complete ignorance about how difficult the work was going to be. Toms enthusiasm, on
the other hand, came from an earlier success. He and
Jurg Ott in 1980 had used non-DNA blood markers to
map a Charcot-Marie-Tooth locus to the Duffy locus,
a polymorphic antigen mapped to chromosome 1 [3].
At the time when this work was done, genetic markers
covered only a few percent of the genome, and there
were no off-the-shelf analysis packages. The CharcotMarie-Tooth locus was the first autosomal neurologic
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
368
Environmental
Aging
Gene 1
Toxins
(early-onset)
Gene 2
Alzheimer s
Disease
(early-onset)
Virus
Gene 3
Trauma
(late-onset)
Down syndrome
(trisomy 21)
Defective gene
Aging
Environmental
Factors
A.
Normal
Aging Processes
Normal
Alzheimer s
Disease
FAD1
B.
Trisomy
21
FAD2
FAD3
Genetic Acceleration
of Aging
369
370
lies, but keeping them separate because we were convinced that genetic heterogeneity was important. This
was still a risky project since there were substantial
segments of the genome not covered by genetic markers. When we finally did get a positive linkage signal
in 1992 [19], the results were breathtaking. I guess
it should not have been surprising that given the right
families, appropriate analysis, and good genetic markers the project would pay off. However, the fact that
the approach really worked after years of preparation,
was still startling. There were several important conclusions that immediately jumped out of the results.
First, we had statistically unambiguous evidence from
our early-onset families for a new Alzheimers disease
gene on chromosome 14. The results were so strong
that the L family, one of our original kindreds, gave
a significant signal by itself. A second gratifying result was that the Volga German families did not show
a chromosome 14 signal, confirming our suspicions of
genetic heterogeneity. Finally, early the next year, we
also showed that the chromosome 14 gene was not responsible for late-onset Alzheimers disease [20]. Not
only did this start the race to identify the actual chromosome 14 gene, but also justified searching for genes for
the Volga German and late-onset Alzheimers disease.
Work on the latter continues to this day.
The early-onset families where Alzheimers disease
was caused by the chromosome 14 gene were relatively
straight-forward. Disease inheritance was clearly autosomal dominant, and the age-of-onset and disease duration were fairly tightly clustered in a given family. The
Volga German kindreds, on the other hand, were significantly more complex. Onset ages ranged from 40
to 82 years with one obligate carrier dying apparently
cognitively intact at age 89. Also the disease duration
was not as short as in the chromosome 14 families and
ranged in the Volga Germans from 8 to over 20 years.
Because of the late-onset of Alzheimers disease in the
Volga German families, some kindreds had a fairly low
density of cases, presumably with some family members dying of other causes prior to Alzheimers disease
onset. Thus the possibility existed that the etiology of
cases in these families could be mixed, with some having an autosomal dominant disease and others simply
having late-onset Alzheimers disease. Another problem with these families was that not only were most of
the parents of the affected subjects missing, there were
also inbreeding loops in several of the families, making
analysis particularly cumbersome. Because of these
difficulties, once we did get an initial signal in 1994 to a
marker on chromosome 1, it took Ellen Wijsman a full
371
References
[1]
[2]
[3]
T.D. Bird, J.P. Hughes, S.M. Sumi, D. Nochlin, G.D. Schellenberg, T.H. Lampe et al., A proposed classification of familial Alzheimers disease based on analysis of 32 multigeneration pedigrees. Alzheimers Disease, in: Epidemiology, Neuropathology, Neurochemistry, and Clinics, Key Topics in Brain
Research, K. Maurer, P. Riederer and H. Beckman, eds, 1990,
pp. 5157.
T.D. Bird, T.H. Lampe, E.J. Nemens, G.W. Miner, S.M. Sumi
and G.D. Schellenberg, Familial Alzheimers disease in American Descendents of the Volga Germans: Probable genetic
founder effect, Ann. Neurol. 23 (1988), 2531.
T.D. Bird, J. Ott and E.R. Giblett, Evidence for linkage of
Charcot-Marie-Tooth neuropathy to the Duffy locus on chromosome 1, Am. J. Hum. Genet. 34 (1982), 388394.
372
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
373
Centre for Brain Repair, Department of Clinical Neurosciences, University of Cambridge, Robinson Way,
Cambridge CB2 2PY, UK
b
Departments of Pathology and Laboratory Medicine (Division of Neuropathology) and Neurology, Indiana
University School of Medicine, Indianapolis, IN 47202, USA
c
MRC Laboratory of Molecular Biology, Hills Road, Cambridge CB2 2QH, UK
Abstract. Work in 1980s and early 1990s established that the microtubuleassociated protein tau is the major component of the paired helical filament
of Alzheimers disease. Similar filamentous deposits are also present in a
number of other diseases, including progressive supranuclear palsy,corticobasal
degeneration and Picks disease. In 1998, the relevance of tau dysfunction for
the neurodegenerative process became clear, when mutations in the tau gene
were found to cause the inherited frontotemporal dementia and parkinsonism
linked to chromosome 17 (FTDP-17). The paper highlighted here [Spillantini
M.G., Murrell J.R., Goedert M., Farlow M., Klug A. and Ghetti B. (1998)
Mutation in the tau gene in familial multiple system tauopathy with presenile dementia. Proc. Natl. Acad. Sci.
USA 95, 77377741] reported a mutation at position +3 in the intron following alternatively spliced exon 10 of
the tau gene in a family with abundant filamentous deposits made exclusively of four-repeat tau. Levels of soluble
four-repeat tau were increased in individuals with this mutation. It was proposed that the +3 mutation destabilises a
stem-loop structure located at the end of exon 10 and the beginning of the intron, thus resulting in an abnormal ratio
of three-repeat to four-repeat tau isoforms.
logical characteristics of the disease that was subsequently named after him. The work in question was
published in the short paper of 1907 [1] and the more
extensive article of 1911 [2]. To this day, abundant neuritic plaques and neurofibrillary lesions constitute the defining neuropathological characteristics
of Alzheimers disease (AD). Although Kidd had described the paired helical filament (PHF) as the major
structural component of the neurofibrillary lesions in
1963 [21], the molecular nature of the PHF was only
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
374
375
Fig. 1. Tau inclusions in familial MSTD brain. Temporal cortex from a patient with familial MSTD showing neurons and glia stained with
phosphorylation-dependent anti-tau antibodies. Neurons and glia in grey matter stained with antibodies AT8 (A), AT180 (D) and PHF1 (G). In
white matter AT8 (B and C), AT180 (E and F) and PHF1 (H and I) stained numerous glial cells with cytoplasmic inclusions (C, F and I). Antibody
12E8 stained granular deposits in neurons and glia in both grey (J) and white matter (K). Magnifications: A, B, D, E, G and H, x140; C,F and I,
x448; J, x760 and K, x112. Taken from Spillantini et al. [35] Copyright (1997) National Academy of Sciences, USA.
376
Fig. 2. Tau filaments from familial MSTD brain. Immunoelectron microscopy of isolated twisted ribbon-like filaments. The top
and bottom panels are unlabelled, and the others are immunogold
decorated with phosphorylation-dependent (PHF1, AT8, AT180 and
AT100) and phosphorylation-independent (133 and 134) anti-tau antibodies. Scale bar, 100 nm. Taken from Spillantini et al. [35]
Copyright (1997) National Academy of Sciences, USA.
377
378
Fig. 4. Mutations in the tau gene (MAPT) in FTDP-17. (a), Schematic diagram of the six tau isoforms (352 to 441 amino acids) that are expressed
in the adult human brain, with mutations in the coding region indicated using the numbering of the 441 amino acid isoform. Twenty-five missense
mutations, two deletion mutations and three silent mutations are shown. The six tau isoforms are produced by alternative mRNA splicing from
a single gene. They differ by the presence or absence of three inserts, shown in red (encoded by exon 2), green (encoded by exon 3) and yellow
(encoded by exon 10), respectively. The migotubule binding repects are indicated by black bars. (b), Stem-loop structure in the pre-mRNA at the
boundary between exon 10 and the intron following exon 10. Nine mutations are shown, two of which (S305N and S305S) are located in exon
10. Exon sequences are boxed and shown in capitals, with intron sequences shown in lowercase letters. The two-dimensional representation of
the MAPT exon splicing regulatory element RNA is based on the three-dimensional structure determined in [41].
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
A. Alzheimer, Uber
eine eigenartige Erkrankung der Hirnrinde, Allg Z Psychiat Psych Gerichtl Med 64 (1907), 146
148.
A. Alzheimer, Uber
eigenartige Krankheitsfalle des spateren
Alters, Z Ges Neurol Psychiat 4 (1911), 356385.
T.D. Bird, E.M. Wijsman, D. Nochlin, M. Leehey, S.M. Sumi,
H. Payami, P. Poorkaj, E. Nemens, M.A. Raskind and G.D.
Schellenberg, Chromosome 17 and hereditary dementia: linkage studies in three non-Alzheimer families and kindreds with
late-onset FAD, Neurology 48 (1997), 949954.
I. DSouza, P. Poorkaj, M. Hong, D. Nochlin, V.M.-Y. Lee,
T.D. Bird and G.D. Schellenberg, Missense and silent tau gene
mutations cause frontotemporal dementia with parkinsonismchromosome 17 type, by affecting multiple alternative RNA
splicing regulatory elements, Proc Natl Acad Sci USA 96
(1999), 55985603.
S. Flament, A. Delacourte, M. Verny, J.J. Hauw and F.
Javoy-Agid, Abnormal tau proteins in progressive supranuclear palsy. Similarities and differences with the neurofibrillary degeneration of the Alzheimer type, Acta Neuropathol 81
(1991), 591596.
N.L. Foster, K. Wilhelmsen, A.A.F. Sima, M.Z. Jones,
C.J. DAmato, S. Gilman, M.G. Spillantini, T. Lynch, R.P.
Mayeux, P.C. Gaskell, C. Hulette, M.A. Pericak-Vance, K.A.
Welsh-Bohmer, D.W. Dickson, P. Heutink, J. Kros, J.C. van
Swieten, F. Arwert, B. Ghetti, J. Murrell, L. Lannfelt, M.
Hutton, C.H. Phelps, D.S. Snyder, E. Oliver, M.J. Ball, J.L.
Cummings, B.L. Miller, R. Katzman, L. Reed, R.L. Schelper,
D.J. Lanska, A. Brun, J.K. Fink, D.E. Khul, D.S. Knopman,
Z. Wszolek, C.L. Miller, T.D. Bird, C. Lendon and C. Elechi,
Frontotemporal dementia and parkinsonism linked to chromosome 17: a consensus conference, Ann Neurol 41 (1997),
706715.
S. Froelich, H. Basun, C. Forsell, L. Lilius, K. Axelman,
A. Andreadis and L. Lannfelt, Mapping of a disease locus
for familial rapidly progressive frontotemporal dementia to
chromosome 17q1221, Am J Med Genet 74 (1997), 380385.
M. Goedert, M.G. Spillantini, R. Jakes, D. Rutherford and
R.A. Crowther, Multiple isoforms of human microtubuleassociated protein tau: Sequences and localization in neurofibrillary tangles of Alzheimers disease, Neuron 3 (1989),
519526.
M. Goedert and R. Jakes, Expression of separate isoforms
of human tau protein: Correlation with the tau pattern in
brain and effects on tubulin polymerization, EMBO J 9 (1990),
42254230.
M. Goedert, M.G. Spillantini, N.J. Cairns and R.A. Crowther,
Tau proteins of Alzheimer paired helical filaments: Abnormal
phosphorylation of all six brain isoforms, Neuron 8 (1992),
159168.
M. Goedert, R. Jakes and R.A. Crowther, Effects of frontotemporal dementia FTDP-17 mutations on heparin-induced
assembly of tau filaments, FEBS Lett 450 (1999), 306311.
M. Goedert, M.G. Spillantini, R.A. Crowther, S.G. Chen, P.
Parchi, M. Tabaton, D.J. Lanska, W.R. Markesbery, K.C. Wilhelmsen, D.W. Dickson, R.B. Petersen and P. Gambetti, Tau
gene mutation in familial progressive subcortical gliosis, Nature Med 5 (1999), 454457.
M. Goedert, A. Klug and R.A. Crowther, Tau protein, the
paired helical filament and Alzheimers disease, J Alz Dis (in
press).
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
379
380
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
Klug and B. Ghetti, Mutation in the tau gene in familial multiple system tauopathy with presenile dementia, Proc Natl Acad
Sci USA 95 (1998), 77377741.
M.G. Spillantini, R.A. Crowther, W. Kamphorst, P. Heutink
and J.C. van Swieten, Tau pathology in two Dutch families
with mutations in the microtubule-binding region of tau, Am J
Pathol 153 (1998), 13591363.
S.M. Sumi, T.D. Bird, D. Nochlin and M.A. Raskind, Familial presenile dementia with psychosis associated with cortical neurofibrillary tangles and degeneration of the amygdala,
Neurology 42 (1992), 120127.
M. Tolnay, M.G. Spillantini, C. Rizzini, D. Eccles, J. Lowe
and D. Ellison, A new case of frontotemporal dementia and
parkinsonism resulting from an intron 10 + 3-splice site mutation in the tau gene: clinical and pathological features, Neuropathol Appl Neurobiol 26 (2000), 368378.
L. Varani, M. Hasegawa, M.G. Spillantini, M.J. Smith, J.R.
Murrell, B. Ghetti, A. Klug, M. Goedert and G. Varani, Structure of tau exon 10 splicing regulatory element RNA and
destabilization by mutations of frontotemporal dementia and
parkinsonism linked to chromosome 17, Proc Natl Acad Sci
USA 96 (1999), 82298234.
M. Wijker, Z.K. Wszolek, E.C.H. Wolters, M.A. Rooimans, G.
Pals, R.F. Pfeiffer, T. Lynch, R.L. Rodnitzky, K.C. Wilhelmsen
and F. Awert, Localization of the gene for rapidly progressive
autosomal dominant parkinsonism and dementia with pallidoponto-nigral degeneration to chromosome 17q21, Hum Mol
Genet 5 (1996), 151154.
K.C. Wilhelmsen, T. Lynch, E. Pavlou, M. Higgins
and T.G. Nygaard, Localization of disinhibition-dementiaparkinsonism-amyotrophy complex to 17q2122, Am J Hum
Genet 55 (1994), 11591165.
Z.K. Wszolek, R.F. Pfeiffer, M.H. Bhatt, R.L. Schelper, M.
Cordes, B.J. Snow, R.L. Rodnitzky, E.C. Wolters, F. Arwert and D.B. Calne, Rapidly progressive autosomal dominant
parkinsonism and dementia with pallido-ponto-nigral degeneration, Ann Neurol 32 (1992), 312320.
T. Yamada, E.G. McGeer, R.L. Schelper, Z.K. Wszolek, P.L.
McGeer, R.F. Pfeiffer and R.L. Rodnitzky, Histological and
biochemical pathology in a family with autosomal dominant
Parkinsonism and dementia, Neurol Psychiat Brain Res 2
(1993), 2635.
L.H. Yamaoka, K.A. Welsh-Bohmer, C.M. Hulette, P.C.
Gaskell, M. Murray, J.L. Rimmler, B.R. Helms, M. Guerra,
A.D. Roses, D.E. Schmechel and M.A. Pericak-Vance, Linkage of frontotemporal dementia to chromosome 17: clinical
and neuropathological characterization of phenotype, Am J
Hum Genet 59 (1996), 13061312.
381
Centre for Research in Neurodegenerative Diseases, Department of Medicine, University of Toronto, 6 Queens
Park Crescent West, Toronto, ON, Canada M5S 3H2
b
Department of Medicine, Division of Neurology, University of Toronto, Toronto, ON, Canada
c
Toronto Western Hospital Research Institute, Toronto Western Hospital, University of Toronto, Toronto, ON,
Canada
Abstract. About 1% of Alzheimers Disease (AD) cases have an early-onset
autosomal dominant familial form of the disease, genetic analyses of which
have found three causal genes: amyloid -protein precursor (APP), presenilin
1 (PS1) and presenilin 2 (PS2). The APOE gene is the only robustly replicated
risk factor for the common form of AD with onset after 65 years of age. In at
least half of the AD cases, there is no known cause of the disease. Here we
provide an overview on known AD-linked genes and discuss the strategies of
searching for novel AD genetic risk factors.
1. Introduction
Alzheimers Disease (AD) is progressive dementia
accompanied by neuronal loss, neurofibrillary tangles
(formed of hyper-phosphorylatedtau microtubule associated protein) and amyloid plaques, consisting mainly
of A40/42 peptides generated by cleavage of the amy-
Corresponding author: Peter St George-Hyslop, Centre for Neurodegenerative Diseases, Department of Medicine, University of
Toronto, 6 Queens Park Crescent West, Toronto, OO, Canada, M5S
3H2. Tel.: +1 416 946 7927; Fax: +1 416 978 1878; E-mail:
p.hyslop@utoronto.ca.
loid -protein precursor (APP). Multiple studies suggest a complex etiology for AD, with both environmental and genetic factors influencing disease pathogenesis. Twin-studies found the concordance rate for
AD among monozygotic twins to be 78%, indicating
a strong genetic influence [2]. More than 95% of AD
cases are sporadic with onset after 65 years of age.
The earliest sign of AD brain pathology is the deposition of extracellular amyloid plaques. The longer
and more neurotoxic isoform (A 42 ) appears to be elevated in the brains of individuals affected with AD.
Numerous genetic and biochemical data support the
amyloid cascade hypothesis, which suggests that A
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
382
deposition is the primary event in disease pathogenesis [12,15,33]. The link between A production and
tau protein is not currently established, although it is
clear that abnormal formation of neurofibrillary tangles
has neurotoxic consequences itself; because mutations
in the tau gene cause frontotemporal dementia [16].
Nevertheless, currently there is no convincing data that
tau is genetically involved in AD.
To date four AD genes have been identified:
APP [13], presenilin 1 (PS1) [35], presenilin 2
(PS2) [19,26] and Apolipoprotein E (APOE) [30,31].
The disease in APP-, PS1- and PS2-linked families
is transmitted as an autosomal dominant trait. In contrast, the APOE 4-allele acts as an AD risk factor and
age-at-onset modifier for the late-onset and early-onset
forms of AD. Importantly, the common pathological
effect of all these genetic factors is to alter APP processing and promote A deposition (reviewed in [27,
36]).
APP: The APP gene is located on chromosome
21q21 and encodes a protein that can be cleaved by at
least two separate pathways. One involves -secretase
cleavage within the A peptide sequence. The other
pathway requires proteolysis by - and -secretases
to generate the A 4042 peptides (reviewed in [36]).
All known pathological APP mutations have a direct
effect on its processing and are clustered near the -,
-, or -secretase cleavage sites [14]. The majority
of them lead to either an elevation of the A 42 peptide, to a more amyloidogenic peptide, or to an increase of both the short and long forms of A. To
date 25 different AD-associated mutations in the APP
gene have been published (including the duplications
of the APP locus), which affect more than 71 families with the age-at-onset ranging between 30 and
65 years (http://www.molgen.ua.ac.be/ADMutations/).
The most frequent pathological mutation is the
Val717Ile substitution, which is found in 50% of
APP-linked families. In addition, some of the APP
mutations are related to hereditary cerebral hemorrhage
with amyloid (congophilic) angiopathy [20,37].
PS1 and PS2: Mutations in the PS1 gene, located
on chromosome 14q24.3, account for 18%50% of
all early-onset AD cases and are responsible for the
most severe form of the disease with the age-at-onset
ranging between 16 and 65 years [9,35]. To date
155 different PS1 mutations (mainly missense substitutions) have been found in more than 315 AD families
(http://molgen-www.uia.ac.be/ADMutations/).
The
Gly206Ala is the most frequent PS1 mutation observed
in 18 unrelated Caribbean Hispanic families [1]. In
383
Multi_ori_age
3.0
2.5
Ala140Asp (rs4925)
FBAT (Age-at-onset) P=0.40
LOD
2.0
PLAU
VR22
CH25H
1.5
1.0
IDE
GSTO1
0.5
cM
0.0
0
20
Variance component
methods using SOLAR
40
60
80
100
120
140
160
DIOS1225
two-point LOD=2.6
Fig. 1. Linkage of age-at-onset to chr10 with AD as a co-variate. Variance component methods using SOLAR were applied to study
linkage/association between chromosome 10 markers and age-at-onset of AD.
chromosome 10 is weak: linkage analysis of 39 microsatellite markers generated only a marginally significant result at position 133 cM (NPL = 1.14; p = 0.06).
However, we have obtained suggestive evidence for an
age-of-onset modifying locus near position 80 cM on
chromosome 10 (Fig. 1). In addition, we genotyped
several case-control and familial datasets with > 140
single nucleotide polymorphisms (SNPs) in the region
90119 cM that is within 1-LOD score of the of the peak
locations identified in the previsouly published linkage
reports [3,11,24]. Our data do not support the notion
that any of the previously proposed candidate genes on
chromosome 10 are sites of prevalent and high effect
alleles causing AD. Thus, analysis of SNPs in insulindegrading enzyme (IDE), cholesterol 25-hydroxylase
(CH25H), plasminogen activator, urokinase (PLAU)
have not generated evidence for linkage or association (p > 0.05). We have also tested allelic associations using a non-synonymous SNP (rs4925) in Glutathione S-Transferase Omega 1 gene (GSTO1), which
has previously been implicated to modify age-at-onset
of AD [22] (Fig. 1). Contrary to the prior report, our
results show no evidence to support a role for GSTO1
as an age-at-onset modifying locus. However, we identified 15 SNPs in a cluster of 10 different genes, which
generate significant results in our case-control or familial datasets. The investigation of addition SNPs in
these genes is currently on the way.
In our North American familial dataset there is much
better evidence for an AD locus on chromosome 12: 34
384
M6PR A2M
LR P1
Linkage to AD on chr12
4.00
LO D
2.00
1.00
0.00
0
10
20
30
40
50
60
70
80
90
100
-1.00
M ap position (cM )
Fig. 2. Linkage of AD to Chromosome 12. The HLODs and GHP lods were generated using Genehunter Plus (GHP). HLODs are parametric
LODscores under heterogeneity, where alpha (fraction of pedigrees linked) was allowed to vary until the HLOD is maximized.
2. Conclusion
The identification of genes bearing polymorphisms
or mutations that cause familial AD has already provided otherwise unattainable starting points from which
to explore the pathogenesis of this disease. Mutations
in the four known AD genes all cause the accumulation
of A peptides as a central and initiating event in the
pathogenesis of disease. Cumulatively the four known
AD genes account for about half of the genetic risk
factors and recent studies have further confirmed the
genetic heterogeneity of AD. However, the conflicting
genetic data generated for numerous gene candidates
and late-onset AD loci in the recent past, reflects the
difficulty of genetic approaches to complex traits in
general, and is not a specific difficulty of AD genetics.
Various strategies have been proposed including the use
of surrogate, simpler endophenotypes (e.g. psychosis,
myoclonus, rapid decline, etc.) [38]. There are several
caveats about these strategies, and currently the most
robust strategy is still the incorporation of biologically
reasonable candidate genes, assessment in large cohorts
of well characterized cases and controls, and replication in independent datasets. An additional important
emerging target for future research in AD is the increasing focus on the genetic epidemiology of AD with
the objective of investigating gene/environment interactions, which are in fact likely to be a significant cause
of the current difficulty as environmental factors can
modify the effects of genetic factors and also introduce
purely non-genetic phenocopies, which confound the
genetic analysis unless their occurrence is incorporated
into the genetic statistical model.
385
References
[1]
386
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
Y.J. Li, S.A. Oliveira, P. Xu, E.R. Martin, J.E. Stenger, C.R.
Scherzer, M.A. Hauser, W.K. Scott, G.W. Small, M.A. Nance,
R.L. Watts, J.P. Hubble, W.C. Koller, R. Pahwa, M.B. Stern,
B.C. Hiner, J. Jankovic, C.G. Goetz, F. Mastaglia, L.T. Middleton, A.D. Roses, A.M. Saunders, D.E. Schmechel, S.R.
Gullans, J.L. Haines, J.R. Gilbert, J.M. Vance, M.A. PericakVance, C. Hulette and K.A. Welsh-Bohmer, Glutathione Stransferase omega-1 modifies age-at-onset of Alzheimer disease and Parkinson disease, Hum Mol Genet 12(24) (15 Dec
2003), 32593267.
R. Mayeux, J.H. Lee, S.N. Romas, D. Mayo, V. Santana, J.
Williamson, A. Ciappa, H.Z. Rondon, P. Estevez, R. Lantigua, M. Medrano, M. Torres, Y. Stern, B. Tycko and J.A.
Knowles, Chromosome-12 mapping of late-onset Alzheimer
disease among Caribbean Hispanics, Am J Hum Genet 70(1)
(Jan 2002), 237243. Epub 2001 Nov 19.
A. Myers, P. Holmans, H. Marshall, J. Kwon, D. Meyer, D.
Ramic, S. Shears, J. Booth, F.W. DeVrieze, R. Crook, M.
Hamshere, R. Abraham, N. Tunstall, F. Rice, S. Carty, S. Lillystone, P. Kehoe, V. Rudrasingham, L. Jones, S. Lovestone, J.
Perez-Tur, J. Williams, M.J. Owen, J. Hardy and A.M. Goate,
Susceptibility locus for Alzheimers disease on chromosome
10, Science 290(5500) (22 Dec 2000), 23042305.
M.A. Pericak-Vance, M.P. Bass, L.H. Yamaoka, P.C. Gaskell,
W.K. Scott, H.A. Terwedow, M.M. Menold, P.M. Conneally,
G.W. Small, J.M. Vance, A.M. Saunders, A.D. Roses and
J.L. Haines, Complete genomic screen in late-onset familial
Alzheimer disease. Evidence for a new locus on chromosome
12, JAMA 278(15) (15 Oct 1997), 12371241.
E.I. Rogaev, R. Sherrington, E.A. Rogaeva, G. Levesque, M.
Ikeda, Y. Liang, H. Chi, C. Lin, K. Holman and T. Tsuda,
Familial Alzheimers disease in kindreds with missense mutations in a gene on chromosome 1 related to the Alzheimers
disease type 3 gene, Nature 376 (1995), 775778.
E. Rogaeva, The solved and unsolved mysteries of the genetics
of early-onset Alzheimers disease, Neuromolecular Med 2(1)
(2002), 110.
E.A. Rogaeva, S. Premkumar, J. Grubber, L. Serneels, W.K.
Scott, T. Kawarai, Y. Song, D.L. Hill, S.M. Abou-Donia,
E.R. Martin, J.J. Vance, G. Yu, A. Orlacchio, Y. Pei, M.
Nishimura, A. Supala, B. Roberge, A.M. Saunders, A.D.
Roses, D. Schmechel, A. Crane-Gatherum, S. Sorbi, A. Bruni,
G.W. Small, P.M. Conneally, J.L. Haines, F. Van Leuven,
P.H. St George-Hyslop, L.A. Farrer and M.A. Pericak-Vance,
An alpha-2-macroglobulin insertion-deletion polymorphism
in Alzheimer disease, Nat Genet 22(1) (May 1999), 1922.
E. Rogaeva, S. Premkumar, Y. Song, S. Sorbi, N. Brindle, A.
Paterson, R. Duara, G. Levesque, G. Yu, M. Nishimura, M.
Ikeda, C. OToole, T. Kawarai, R. Jorge, D. Vilarino, A.C.
Bruni, L.A. Farrer and P.H. George-Hyslop, Evidence for an
Alzheimer disease susceptibility locus on chromosome 12 and
for further locus heterogeneity, JAMA 280 (1998), 614618.
A.D. Roses, Apolipoprotein E and Alzheimers disease. The
tip of the susceptibility iceberg, Ann N Y Acad Sci 855 (1998),
738743.
A.M. Saunders, W.J. Strittmatter, D. Schmechel, P.H. GeorgeHyslop, M.A. Pericak-Vance, S.H. Joo, B.L. Rosi, J.F. Gusella,
D.R. Crapper-MacLachlan and M.J. Alberts, Association of
apolipoprotein E allele epsilon 4 with late-onset familial and
sporadic Alzheimers disease, Neurology 43 (1993), 1467
1472.
D.E. Schmechel, A.M. Saunders, W.J. Strittmatter, B.J. Crain,
C.M. Hulette, S.H. Joo, M.A. Pericak-Vance, D. Goldgaber
and A.D. Roses, Increased amyloid beta-peptide deposition in
387
389
Keywords: Dementia, Alzheimers disease, Cerebral Amyloid Angiopathy (CAA), cerebral hemorrhages, APP mutations,
Flemish APP692 disease, HCHWAD
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
390
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
plaques, and arteriosclerotic senile dementia characterized by vascular degeneration; the latter entity is
still recognized today as vascular dementia. However,
the recognition of congophilic (cerebral) amyloid angiopathy (CAA) as another hallmark of AD led into
yet another controversy that continues even today: is
there an overlap between AD and vascular dementia?
This controversy is most important to this review, as we
shall discuss APP mutations that are linked to strokes
and present recent findings that development of senile
plaques could be related to cerebral vessels.
A better structural characterization of the aggregate
lesions was obtained by electron microscopy showing
that tangles contained 1020 nm paired helical filaments (PHF) and that the amyloid within vessels contained 10 nm thick filaments similar to the amyloid
observed in the senile plaques. The subsequent use
of x-ray diffraction and infrared spectroscopy demonstrated a characteristic cross- conformation and suggested that the common features of amyloid protein in
different diseases might be the cross- conformation.
Purification and biochemical characterization of AD
aggregates launched another era of AD research. Ironically, the first amyloid characterized to be 4 kDa
amyloid- (A) peptides were amyloid isolated from
CAA from AD and Downs syndrome (DS) patients
and not from senile plaques [23,24]. Soon after, the
amyloid protein of senile plaques was shown to be identical to the A peptide [60]. Studies on neurofibrillary
tangles (NFT) and PHF were a bit more intricate due to
their difficult solubilization, but the breakthrough came
from histochemistry. Initially, however, microtubules
were implicated because microtubule-associated proteins (MAP) like MAP-2 and tau inadvertently contaminated the purification process of microtubules [31,
100], but soon this controversy was closed with phosphorylated tau being recognized as the major, if not the
only, component of PHF [26,30,48,68].
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
391
392
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
Fig. 1. The APP mutations within the region encoding for A at the -secretase site associate with CAA, and some associate with AD changes
as well. This location contrasts with APP mutations associated primarily with AD that flank the A region (i.e., Swedish and London APP
mutations).
Fig. 2. Spectrum of diseases from primarily hereditary amyloidosis to pure familial forms of Alzheimers disease. The upper panel depicts A
staining with 4G8 in an HCHWAD (E693Q) patient with CAA, Flemish AD patient with both CAA and plaques, PSEN1 (L282V) AD with
prominent CAA, and classical AD patient with PSEN1 (I143T) from our AD/A pedigree. The lower panel is AT8-phosphorylated tau staining in
temporal cortical region of the same patients. Note HCHWAD brain does not show tau staining and both Flemish AD and PSEN1 L282V show
phosphorylated tau (AT8) staining around CAA as observed for the neuritic plaques. Bars represent 10 m.
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
393
Table 1
Clinical and biochemical characteristics of mutations near the -secretase site of APP
APP Codon*
692
693
694
Substitution
Ala>Gly
Glu>Gln
Glu>Gly
Glu>Lys
Asp>Asn
Position within A
A21G
E22Q
E22G
E22K
D23N
Nick name
Flemish
Dutch
Arctic
Italian
Iowa
Clinics
EOAD/Cerebral hemorrhage
Cerebral hemorrhage
EOAD/Vascular symptomatology
Cerebral hemorrhage
EOAD
References
[39,49]
[55,86]
[46,66]
[63]
[27]
for vessels and not for parenchyma as the enormous aggregates observed in vitro never occur in close proximity to neuronal cells in HCHWAD patients. Conversely,
slowly fibrilizing Flemish A diffuse more readily in a
relatively soluble or low-fibrillar toxic form to the nidi
of plaque formation. The same year, we also showed
that dense-core plaques in Flemish APP692 patients
were centered on vascular walls [49], which might be
one of the major pathways of A brain clearance for
Flemish A as suggested for wild type A [4,14,15,
61,74,87,96,101]. This not only brought the 2 major
types of amyloid deposits as spectrum of the same disease mechanism, but also connected parenchymal and
vascular dementia.
The remaining -secretase site-related APP mutations neatly fit into the spectrum of HCHWAD
and Flemish AD clinical and pathological descriptions (where available). For the Italian peptide,
increased propensity to make fibrils and peptidemediated pathogenic effects was similar to the Dutch
peptide and not surprisingly, resembled clinicopathology of HCHWAD (CAA and hemorrhagic strokes) [62,
64]. The Arctic mutation is also most likely due to
increased propensity of protofibril formation without
necessarily increasing the rate of fibril formation or the
amounts of A [66]. Iowa mutation resembling both
Flemish APP692 and HCHWAD pathologically (a severe degree of CAA and predominantly diffuse plaques
with some dense-core plaques [27]), shows cytotoxicity and aggregation properties that lie between those
caused by the Flemish and Dutch A peptides [64].
None of these pathological descriptions, however, recapitulate the large and abundant dense-cores characteristic of Flemish AD pathology as none of the mutant
A parallel the low fibrillogenic potential of Flemish
A.
5. Transgenic mice studies deciphering CAA and
dense-core plaque pathology: potential for
therapeutics
Essential clues in A catabolism, trafficking, and
formation of CAA and dense-core plaques have also
394
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
7. Conclusions
With a brief historical recount of all major events
in AD research, we focused in this review on
the genotype-proteotype-phenotype studies related to
APP -secretase site mutations and show how research in this direction has facilitated in pinpointing
the role of CAA and other vascular abnormalities in
the clinics and in the pathology of AD. Especially, we
suggested that CAA should be considered an important
contributing factor in the progressive cognitive decline
observed in AD. We also discussed how multi-level investigations on Flemish AD have helped identify the
mechanism of dense-core plaque formation, which has
also been extended to some of the mouse AD models.
While future studies will address the generality of some
of the observations, detailed clinical, neuropathologi-
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
cal, and biochemical descriptions of families or individual patients with unusually severe CAA are likely
to contribute to our understanding of the role of CAA
in dementia.
[16]
[17]
[18]
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
395
396
[32]
[33]
[34]
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
J.F. Gusella, N.S. Wexler, P.M. Conneally et al., A polymorphic DNA marker genetically linked to Huntingtons disease,
Nature 306 (1983), 234238.
J. Haan, J.A. Hardy and R.A.C. Roos, Hereditary cerebral
hemorrhage with amyloidosis-Dutch type: its importance for
Alzheimer research, 14 (TINS), 231234.
C. Haass, A.Y. Hung, D.J. Selkoe and D.B. Teplow, Mutations associated with a locus for familial Alzheimers disease result in alternative processing of amyloid beta-protein
precursor, J Biol Chem 269 (1994), 1774117748.
J. Hardy and D.J. Selkoe, The amyloid hypothesis of
Alzheimers disease: progress and problems on the road to
therapeutics, Science 297 (2002), 353356.
J.A. Hardy and G.A. Higgins, Alzheimers disease: The
amyloid cascade hypothesis, Science 256 (1992), 184185.
D.M. Hartley, D.M. Walsh, C.P. Ye et al., Protofibrillar intermediates of amyloid beta-protein induce acute electrophysiological changes and progressive neurotoxicity in cortical
neurons, J Neurosci 19 (1999), 88768884.
H. Hayashi, N. Kimura, H. Yamaguchi et al., A seed for
Alzheimer amyloid in the brain, J Neurosci 24 (2004), 4894
4902.
L. Hendriks, C.M. van Duijn, P. Cras et al., Presenile dementia and cerebral haemorrhage linked to a mutation at condon
692 of the b-amyloid precursor protein gene, Nat Genet 1
(1992), 218221.
M.C. Herzig, D.T. Winkler, P. Burgermeister et al., A beta
is targeted to the vasculature in a mouse model of hereditary
cerebral hemorrhage with amyloidosis, Nature Neuroscience
7 (2004), 954960.
L. Holcomb, M.N. Gordon, E. McGowan et al., Accelerated Alzheimer-type phenotype in transgenic mice carrying
both mutant amyloid precursor protein and presenilin 1 transgenes, Nat Med 4 (1998), 97100.
D.S. Howland, M.J. Savage, F.A. Huntress et al., Mutant and
native human beta-amyloid precursor proteins in transgenic
mouse brain, Neurobiol Aging 16 (1995), 685699.
K. Hsiao, P. Chapman, S. Nilsen et al., Correlative memory
deficits, Abeta elevation, and amyloid plaques in transgenic
mice, Science 274 (1996), 99102.
M. Ikeda, V. Sharma, S.M. Sumi et al., The clinical phenotype
of two missense mutations in the presenilin I gene in Japanese
patients, Ann Neurol 40 (1996), 912917.
J.T. Jarrett, E.P. Berger and P.T. Lansbury Jr., The carboxy
terminus of the -amyloid protein is critical for the seeding
of amyloid formation: Implications for the pathogenesis of
Alzheimers disease, Biochemistry 32 (1993), 46934697.
K. Kamino, H.T. Orr, H. Payami et al., Linkage and mutational analysis of familial Alzheimer disease kindreds for the
APP gene region, Am J Hum Genet 51 (1992), 9981014.
J. Kang, H-G. Lemaire, A. Unterbeck et al., The precursor
of Alzheimers disease amyloid A4 protein resembles a cellsurface receptor, Nature 325 (1987), 733736.
K.S. Kosik, L.D. Orecchio, L. Binder, J.Q. Trojanowski,
V.M. Lee and G. Lee, Epitopes that span the tau molecule
are shared with paired helical filaments, Neuron 1 (1988),
817825.
S. Kumar-Singh, P. Cras, R. Wang et al., Dense-core senile
plaques in the Flemish variant of Alzheimers disease are
vasocentric, Am J Pathol 161 (2002), 507520.
S. Kumar-Singh, C. De Jonghe, M. Cruts et al., Nonfibrillar
diffuse amyloid deposition due to a gamma(42)-secretase site
mutation points to an essential role for N-truncated abeta(42)
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
[66]
[67]
[68]
[69]
[70]
[71]
[72]
[73]
[74]
[75]
[76]
[77]
[78]
[79]
[80]
[81]
[82]
[83]
[84]
[85]
[86]
[87]
[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
397
L. van Bogaert, M. Maere and E. de Smedt, Sur les formes familiales precoces de la maladie dAlzheimer, Mschr Psychiat
Neurol 102 (1940), 249301.
C. Van Broeckhoven, H. Backhovens, M. Cruts et al., Mapping of a gene predisposing to early-onset Alzheimers disease to chromosome 14q24.3, Nat Genet 2 (1992), 335339.
C. Van Broeckhoven, A.M. Genthe, A. Vandenberghe et al.,
Failure of familial Alzheimers disease to segregate with the
A4-amyloid gene in several European families, Nature 329
(1987), 153155.
C. Van Broeckhoven, J. Haan, E. Bakker et al., Amyloid beta
protein precursor gene and hereditary cerebral hemorrhage
with amyloidosis (Dutch), Science 248 (1990), 11201122.
J. Van Dorpe, L. Smeijers, I. Dewachter et al., Prominent
cerebral amyloid angiopathy in transgenic mice overexpressing the london mutant of human APP in neurons [In Process
Citation], Am J Pathol 157 (2000), 12831298.
S.G. van Duinen, E.M. Castano, F. Prelli, G.T.A.B. Bots, W.
Luyendijk and B. Frangione, Hereditary cerebral hemorrhage
with amyloidosis in patients of Dutch origin is related to
Alzheimer disease, Proc Natl Acad Sci USA 84 (1987), 5991
5994.
W.E. Van Nostrand, J. Davis-Salinas and S.M. SaporitoIrwin, Amyloid beta-protein induces the cerebrovascular cellular pathology of Alzheimers disease and related disorders,
Ann N Y Acad Sci 777 (1996), 297302.
R. Vassar, B.D. Bennett, S. Babu-Khan et al., Beta-secretase
cleavage of Alzheimers amyloid precursor protein by the
transmembrane aspartic protease BACE [see comments], Science 286 (1999), 735741.
R. Vidal, M. Calero, P. Piccardo et al., Senile dementia associated with amyloid beta protein angiopathy and tau perivascular pathology but not neuritic plaques in patients homozygous for the APOE-epsilon4 allele, Acta Neuropathol (Berl)
100 (2000), 112.
D.M. Walsh, D.M. Hartley, M.M. Condron, D.J. Selkoe and
D.B. Teplow, In vitro studies of amyloid beta-protein fibril
assembly and toxicity provide clues to the aetiology of Flemish variant (Ala692>Gly) Alzheimers disease, Biochem J
355 (2001), 869877.
D.M. Walsh, I. Klyubin, J.V. Fadeeva et al., Naturally secreted oligomers of amyloid beta protein potently inhibit hippocampal long-term potentiation in vivo, Nature 416 (2002),
535539.
Z. Wang, R. Natte, J.A. Berliner, S.G. van Duinen, H.V.
Vinters and W.I. Rosenblum, Toxicity of Dutch (E22Q) and
Flemish (A21G) mutant amyloid beta proteins to human cerebral microvessel and aortic smooth muscle cells, Stroke 31
(2000), 534538.
D.J. Watson, D.J. Selkoe and D.B. Teplow, Effects of the
amyloid precursor protein Glu693>Gln Dutch mutation on
the production and stability of amyloid beta-protein, Biochem
J 340 (1999), 703709.
R.O. Weller, A. Massey, T.A. Newman, M. Hutchings, Y.M.
Kuo and A.E. Roher, Cerebral amyloid angiopathy: amyloid beta accumulates in putative interstitial fluid drainage
pathways in Alzheimers disease, Am J Pathol 153 (1998),
725733.
K.E. Wisniewski, A.J. Dalton, D.R. Crapper-McLachlan,
G.Y. Wen and H.M. Wisniewski, Alzheimers disease in
Downs syndrome: Clinicopathologic studies, Neurology 35
(1985), 957961.
T. Wisniewski, J. Ghiso and B. Frangione, Peptides homologous to the amyloid protein of Alzheimers disease contain-
398
C.V. Broeckhoven and S. Kumar-Singh / Genetics and pathology of alpha-secretase site APP mutations
ing a glutamine for glutamic acid substitution have accelerated amyloid fibril formation, Biochem Biophys Res Commun
179 (1991), 12471254.
[99] M. Yasuda, K. Maeda, Y. Ikejiri, T. Kawamata, S. Kuroda
and C. Tanaka, A novel missense mutation in the presenilin-1
gene in a familial Alzheimers disease pedigree with abundant amyloid angiopathy, Neurosci Lett 232 (1997), 2932.
[100]
401
1. Introduction
Despite the advances of the last century, the most
significant hurdle to the development of effective therapeutics for Alzheimers disease is, perhaps, a sensitive,
specific biomarker of disease progression. It is hard to
argue with the elegance of an imaging technique that
would allow early diagnosis and anatomically specific
monitoring of the disease. Diseases like cancer and
stroke have benefited from diagnostic imaging that allows direct assessment of therapeutic interventions. No
such technique has existed for AD until recently. There
have been several advances in indirect imaging of the
disease with FDG-PET and high resolution MRI, that
while lacking specificity, have been used with success
Corresponding author: Brian J. Bacskai, PhD, Department
of Neurology/Alzheimers Disease Research Laboratory, Massachusetts General Hospital, 114 16th Street, #2850, Charlestown,
MA 02129, USA. Tel.: +1 617 724 5306; Fax: +1 617 724 1480;
E-mail: bbacskai@partners.org.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
402
J. Skoch et al. / Preclinical characterization of amyloid imaging probes with multiphoton microscopy
2. Multiphoton microscopy
Multiphoton microscopy is an optical imaging technique similar to confocal microscopy that allows
diffraction-limited spatial resolution of cellular and
sub-cellular structures using a scanning laser for excitation of fluorescence. Both techniques result in 3dimensional images with optical sectioning achieved
in different ways. Multiphoton microscopy is advantageous when imaging thick scattering tissue like intact brain, live cells, and fluorophores that require UV
excitation. The photophysical phenomenon of multiphoton excitation of fluorescence is simply described
as the simultaneous acceptance of two low energy photons (in the near infrared) that would normally match
the single photon acceptance of a higher energy photon
(in the UV or blue region.) This is achieved by means
of a pulsed near infrared laser with low average power,
but very high peak power, and concomitant focusing of
the light to further increase the local photon flux. This
increases the probability that a fluorophore will accept
two low-energy photons nearly simultaneously. The
end result is that near infrared excitation, possessing the
advantage of deeper penetration through scattering tissue with minimal phototoxicity, excites a broad range
of fluorophores only at the plane of focus, allowing a
narrow depth of field with confocal-like optical sectioning without photodamage above or below the plane
of focus or the need for a signal-reducing pinhole [9].
The end result is sub-micron spatial resolution in three
dimensions deep within living tissue. Figure 1 shows
an example of simultaneous 2-color fluorescence detection in the brain of a living transgenic mouse using
multiphoton microscopy.
While the technique can exploit extrinsic signals,
they are inherently weak. Alzheimers disease research, however, has been endowed with a selection of
amyloid binding fluorophores that have been used and
characterized for decades. Our initial studies exploited
the fluorescence of thioflavin S as an amyloid binding reagent. Thioflavin S is a small, diffusible, nontoxic fluorophore that binds specifically to the betasheet structure of dense-core plaques in the brain. It ab-
J. Skoch et al. / Preclinical characterization of amyloid imaging probes with multiphoton microscopy
403
Fig. 2. Representation of 4-dimensional in vivo multiphoton recording of the fluorescent biomarker PIB in the brain of a Tg2576
mouse. Three discreet time points are shown here simultaneously as
two-dimensional projections (maximum intensity) of their respective
3D volumes. Blue pseudocolor corresponds to the dye visible in the
volume immediately after i.v. injection, green 5 min later, and red at
t = 20 min. PIB enters the brain, is rapidly cleared from circulation,
and targets vascular and parenchymal amyloid deposits with high
specificity, making it a suitable in vivo biomarker.
404
J. Skoch et al. / Preclinical characterization of amyloid imaging probes with multiphoton microscopy
J. Skoch et al. / Preclinical characterization of amyloid imaging probes with multiphoton microscopy
405
5. Conclusions
Acknowledgements
This work was supported by NIH AG020570,
EB00768 (BJB), AG08487, and a Pioneer Award from
the Alzheimer Association (BTH).
406
J. Skoch et al. / Preclinical characterization of amyloid imaging probes with multiphoton microscopy
References
[16]
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
J. Skoch et al. / Preclinical characterization of amyloid imaging probes with multiphoton microscopy
[30]
K. Sakatani, Y. Xie, W. Lichty, S. Li and H. Zuo, Languageactivated cerebral blood oxygenation and hemodynamic
changes of the left prefrontal cortex in poststroke aphasic patients: a near-infrared spectroscopy study, Stroke 29 (1998),
12991304.
[31] K. Shoghi-Jadid, G.W. Small, E.D. Agdeppa, V. Kepe, L.M.
Ercoli, P. Siddarth, S. Read, N. Satyamurthy, A. Petric, S.C.
Huang and J.R. Barrio, Localization of neurofibrillary tangles
and beta-amyloid plaques in the brains of living patients with
Alzheimer disease, Am J Geriatr Psychiatry 10 (2002), 2435.
[32] A.M. Siegel, J.P. Culver, J.B. Mandeville and D.A. Boas, Temporal comparison of functional brain imaging with diffuse optical tomography and fMRI during rat forepaw stimulation,
Phys Med Biol 48 (2003), 13911403.
[33] J. Skoch, A. Dunn, B.T. Hyman and B.J. Bacskai, Development of an optical approach for non-invasive imaging of
Alzheimers disease pathology, J Biomed Opt 10 (2005),
011007.
[34]
407
409
Keywords: Diagnosis, dementia, Alzheimers disease, mild cognitive impairments, MCI, diagnostic criteria, biomarkers, diagnostic instruments, neuroimaging, National Institute on Aging, NIA, NIH
1. Introduction
The 1985 article in the Archives of Neurology, Diagnosis of Alzheimers Disease [1] represents a small
chapter in the prolonged efforts to characterize the
distinct clinical-pathological features of Alzheimers
disease (AD). Although the study of dementia has a
one hundred-year history, the attempt to address systematically the array of scientific and clinical issues
related to differential diagnosis is a relatively recent
phenomenon. This paper is an account of the early
history of the struggles to define the disease and the
more recent efforts at the National Institute on Aging
(NIA)/National Institutes of Health (NIH) to establish:
diagnostic criteria, standardized clinical assessment algorithms, and validated screening instruments and/or
biological markers.
2. Early history
Although various forms of dementia have always
been part of the human experience, the efforts for sys-
tematic description of the clinical-pathological characteristics of phenomenon gained traction in the late
1890s roughly paralleling advances in histology (chemistry of tissue stains), light microscopy, neuroanatomy
and other areas of biology [2,3]. The early pioneers
of the field were able to make some groundbreaking
observations about dementia because of access to a
wealth of new technologies for studying the brain and
the emergence of vibrant academic environments that
fostered interactions and cross-fertilization among psychiatrist, neurologist and neuropathologist. Reports
by Blocq and Marinesco [1892] and later by Redlich
[1898] began to describe the relationships between neocortical senile plaques and senile dementia. Oskar
Fisher [1907] was one of the first to suggest that severity
of dementia and memory loss might be associated with
senile plaques. Alois Alzheimer, a psychiatrist with an
abiding interest to help psychiatry through the microscope, was among the first to exploit the newly emerging tools for histological study of the human brain. The
1907 paper by Alois Alzheimer became the index case
for Alzheimers Disease, however the term did not
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
410
plaque), 3) develop methods of isolating plaques, neurofibrillary tangles and preparation of enriched PHFs,
and 4) set the stage for the discovery of more sophisticated molecular and immunological probes to further
characterize the abnormal proteins associated with the
disease. Thus, these early ultrastructural studies by
Terry, Kidd and colleagues opened the door for more
detailed molecular characterization of the two fibrous
proteins and set the stage for the remarkable advances
of the last few years in understanding the molecular
neurobiology of AD.
The need for functional measures of severity and
objective/quantitative tools to assess mental status was
the crucial hurdles for progress in clinical/behavioral
studies of this period. This problem was surmounted
in 1968, with the publication of the Blessed, Tomlinson and Roth Dementia Scale (Information-MemoryConcentration Test). This was an informant-based
scale of memory function, orientation, information,
concentration, activities of daily living, etc. The landmark prospective studies of this group for the first time
correlated quantitative measures of dementia (cognitive and functional impairments) with estimates of the
number of the lesions (plaques), and the volume of
brain destroyed by infarcts. These efforts to quantify
the relationships between the clinical and biological indices of the disease established the foundation for subsequent program initiatives and several collaborative
multi-site longitudinal studies launched by NIA. In the
mid-1960 to mid-1980 period, four categories of objective clinical measurement tools were developed and
validated, some in longitudinal studies with autopsy
confirmations. These include: Mental Status Exams
(e.g., Dementia Scale or ICM Test-1968, Mini-Mental
Status Exam -1975 [5], Short Blessed Test -1983),
Global Measures of Dementia Severity (e.g., Clinical
Dementia Rating 1993, Global Deterioration Scale
1982, CAMDEX -1986), Behavioral Scales (Geriatric
Depression Scale 1988, Agitation Inventory 1986,
CERAD Behavioral Rating Scale for Dementia 1995,
Clinical Impression of Global Change or CIBIC) and
Cognitive Assessment Batteries (e.g., Alzheimer Disease Assessment Scale or ADAS-cog) [6]. The efforts
to construct quantitative measures of cognition and the
validation of instruments for objective evaluation of
symptoms were critical to the refinements in the characterization of the disease. These advances in assessment of the severity of the disease became the foundation for much of the current routine clinical-workup
and set the standard for clinical staging methods an
essential element of clinical research.
411
412
tem supporting comparisons across centers, d) Glenner and Wong identified amyloid, e) Consortium to
Establish Registries for Alzheimers disease (CERAD)
(1987), and f) Alzheimers Disease Cooperative Study
(ADCS) (1991).
Once the challenges of developing diagnostic criteria and objective assessment instruments were overcome, the next major impediment for clinical research
was the effort to 1) validate the diagnostic criteria with
histopathological confirmations; thus the need for neuropathologic criteria, 2) standardize (reliability, sensitivity, specificity) various clinical assessment instruments, and 3) construct new measurements for changes
in behaviors, symptoms of various domains of cognition. The availability of standardized, well-validated
quantitative assessment instruments were indispensable prerequisites for NIAs subsequent initiatives [e.g.,
Centers Program; CERAD; ADCS; ADNI etc].
To address the long-term strategic goal of developing
treatments, it was necessary for NIA to build a) mechanisms for promoting collaborative research, b) the capability of the field to conduct longitudinal clinical research and clinical trials and c) infrastructure for clinical research. The NIA began to create the necessary
national research infrastructure. The Alzheimers Disease Research Centers (ADRCs), established in 1984
and the Alzheimers Disease Core Centers (ADCCs),
established in 1990, were central components of the
research and capability infrastructure. These programs
referred to as the Alzheimers Disease Centers or ADCs
provide the infrastructure for integrating clinical and
basic science research and allowed the augmentation
of a wide range of studies on the etiology and pathogenesis of AD. In 1991 the Satellite Clinics program
was established to fund outreach to underserved or rural patient groups now Satellites are an integral part of
many ADCs.
The Alzheimers Disease Patient Registry Program
(ADPR) was launched in 1986 to address the goal of
developing standardized diagnostic assessments. This
program included the Consortium to Establish a Registry for AD (CERAD) led by Al Heyman and Gerda
Fillenbarum, the Mayo Clinic Registry led by Len Kurland and Ron Peterson, the Seattle site led by Eric Larson, the Mon valley project with Lewis Kuller and Mary
Ganguli, and Denis Evanss group in East Boston. The
CERAD project was successful in establishing uniform
methods for the diagnosis and assessment of AD because of the dedicated and effective leadership provided by Al Heyman and the cooperation of clinicians
and investigators nation and worldwide. The ADPR
413
414
References
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[12]
415
Consensus Report of the Work Group, Molecular and Biochemical Markers of Alzheimers Disease, The Ronald and
Nancy Reagan Research Institute of the Alzheimers Association and the National Institute on Aging Work Group, Neurobiol Aging 19 (1998), 109116.
417
1. Background
This ambitiously titled paper [1] appeared in Neurology in November 1996 as an account of the First
International Workshop on Dementia with Lewy Bodies (DLB) which Elaine and Robert Perry and I had
organised in Newcastle upon Tyne in October 1995.
We took this initiative for several reasons. Research
into Lewy body (LB) related dementia had started to
gain momentum during the previous 4 or 5 years with
the publication of several articles about small series
of patients who had a clinical history of dementia and
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
418
I.G. McKeith / Consensus guidelines for the clinical and pathologic diagnosis of dementia with Lewy bodies (DLB)
posed. This coincided with the introduction of antiubiquitin immunocytochemistry as a sensitive way to
visualise cortical LB [16]. In the early 1990s, the various groups most interested in the disorder (in Yokohama, San Diego, New York, Nottingham and Newcastle) were starting to diverge in developing concepts and
terminology about what were in all probability the same
group of patients. This was a potentially damaging
trend. For LB dementia research to advance rapidly it
needed a collaborative approach and a common brand.
This was the prime mover behind DLB1 as the First
International Workshop is now known.
The outputs of DLB1 were the Consensus Guidelines paper and a edited book comprising chapters from
94 contributors who attended the meeting [17]. Looking back at the reports it is clear that the clinicians in
the group were motivated to generate diagnostic criteria in the hope that the majority LB pathology cases
might be detected by purely clinical methods. The
pathologists by contrast wanted to agree a framework
of methods for assessing and reporting LB and Lewy
related pathologies without committing themselves to
defining diagnostic categories. They succeeded in describing three patterns of LB disease (brainstem predominant, limbic [transitional] and neocortical) based
upon semi-quantitative LB counts and they dealt with
the ever troublesome issue of concomitant Alzheimer
pathology (predominantly amyloid plaques, less frequently tangles) by saying that its presence should be
documented and its significance was unclear. Brain areas to be examined were specified in detail, but staining methods for LB were left optional (H&E or antiubiquitin). The term DLB was agreed by all parties
because it was agnostic as to the causative role of LB
in symptom formation and because the term had not
been used previously so belonged to the group rather
to any one of the participating players. Coalescing the
various terms in use at the time under the one umbrella
DLB, was probably the single most important step to
secure acceptance of the disorder. Despite being a little
unwieldy and containing the word dementia which is
disliked by many, DLB has been adopted globally and
the abbreviation seems useable by clinicians, carers and
patients alike. It has made it possible to use standard
criteria to recruit patients into clinical and neuroimaging trials and other investigative studies with a 30 fold
expansion of published literature over the last ten years.
2. Immediate reaction
The 1996 paper was written within six months of the
DLB1 meeting and published six months after that. Re-
I.G. McKeith / Consensus guidelines for the clinical and pathologic diagnosis of dementia with Lewy bodies (DLB)
419
420
I.G. McKeith / Consensus guidelines for the clinical and pathologic diagnosis of dementia with Lewy bodies (DLB)
7. Genetics
It is clear from several case studies that familial cases
of DLB occur [51,52] and that LBs are commonly seen
in familial cases of AD [53]. There are recent reports
that triplication of the alpha-synuclein gene (SNCA)
can cause DLB, PD and PDD whereas gene duplication
is associated only with motor PD suggesting a gene
dose effect [54]. However, SCNA multiplication is not
found in most LB disease patients [55]. Continued
clinical, pathological and genetic evaluation of familial
cases of DLB and AD is therefore an important and potential highly informative area for continued research.
8. Clinical advances
Probably one of the most important consequences of
the paper was that publication of operationalised clinical diagnostic criteria meant that DLB patients could
be recruited into clinical studies, in particular imaging
studies and treatment trials. The imaging studies have
shown possibilities to improve case detection and open
label studies have demonstrated the effectiveness of
all three generally available CHEIs in DLB and PDD.
Placebo controlled trial data is only available to date for
rivastigmine [56,57]. The reported reduction in symptom frequency and intensity of VH appears to be mediated at least in part by improved attentional function
and the presence of VH is associated with greater cog-
I.G. McKeith / Consensus guidelines for the clinical and pathologic diagnosis of dementia with Lewy bodies (DLB)
nitive improvement [58]. Side effects of hypersalivation, lacrimation, and urinary frequency may occur, in
addition to the usual gastro-intestinal symptoms and a
dose dependent exacerbation of extrapyramidal motor
features may occur in a minority [59] The number of
patients entered into trials has however been modest
and neither DLB nor PDD are yet recognised indications for CHEIs. As a result prescribing remains offlicence and in some localities is actively discouraged
by funding restrictions, formulary committees or other
guidelines.
421
resting the neurodegenerative process. A useful clinical objective would be for our clinical diagnostic methods to have improved to such a point that patients with
DLB were reliably identifiable in the earliest stages of
disease when application of such a treatment would
be of most benefit. If one makes analogy with the
current status of amnestic mild cognitive impairment
(MCI) as a predictor for AD, it is clear that defining
the MCI equivalent of LB disease is likely to be a difficult task. Research effort needs to be directed towards
early detection of LB disease, likely using biological
markers such as dopamine transporter imaging in patients showing evidence of possible early symptoms.
For those with established DLB we need better symptomatic treatments. This may involve new drug discovery but there is huge scope for improvement in the management of individual patients using tailored regimes
of currently available medications. Specialist clinics
for DLB patients may be one way to deliver these, and
they could be embedded within existing provision for
people with dementia or movement disorders.
One of the most important aspects of the 1996 paper was that it had impact on several fronts clinical
practice, clinical and laboratory research, dementia and
movement disorder communities. A second report was
published in 1999 [60] which reviewed the accumulating literature and made a few minor modifications to
the clinical criteria. It performed a useful holding function while the exciting developments briefly outlined
above were taking place. In October 2003 the Consortium on DLB met for the third time and significant
amendments to the clinical and pathological guidelines
were agreed and treatment recommendations offered
for the first time [61]. These have been framed in response to critical reviews of DLB1 with the aims of
improving diagnostic reliability and sensitivity, clarifying the nature of relationships with AD and PD and
recognising the broader concepts of LB disease/alphasynucleinopathy. The hope is to maintain the pace of
advance that followed the 1996 paper. Virtually unrecognised 20 years ago, DLB could within this decade
be one of the best characterised and potentially treatable
neurodegenerative disorders of late life.
References
[1]
I.G. McKeith, D. Galasko, K. Kosaka et al., Consensus guidelines for the clinical and pathologic diagnosis of dementia
with Lewy bodies (DLB): Report of the consortium on DLB
international workshop, Neurology 47 (1996), 11131124.
422
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
I.G. McKeith / Consensus guidelines for the clinical and pathologic diagnosis of dementia with Lewy bodies (DLB)
G. Lennox, J. Lowe, E.J. Byrne, M. Landon, R.J. Mayer and
R.B. Godwin-Austen, Diffuse Lewy body disease, Lancet 11
(February 1989), 323324.
W.R.G. Gibb, M.M. Esiri and A.J. Lees, Clinical and pathological features of diffuse cortical Lewy body disease (Lewy
body dementia), Brain 110 (1987), 11311153.
C.R. Burkhardt, C.M. Filley, B.K. Kleinschmidt-DeMasters,
S. de la Monte, M.D. Norenberg and S.A. Schneck, Diffuse
Lewy body disease and progressive dementia, Neurology 38
(1988), 15201528.
E.J. Byrne, G. Lennox, J. Lowe and R.B. Godwin-Austen,
Diffuse Lewy body disease: clinical features in 15 cases,
Journal of Neurology, Neurosurgery and Psychiatry 52 (1989),
709717.
R.H. Perry, D. Irving, G. Blessed, E.K. Perry and A.F. Fairbairn, Clinically and neuropathologically distinct form of dementia in the elderly, Lancet 21 (January 1989), 166.
H.A. Crystal, D.W. Dickson, J.E. Lizardi, P. Davies and L.I.
Wolfson, Antemortem diagnosis of diffuse Lewy body disease,
Neurology 40 (1990), 15231528.
L. Hansen, D. Salmon, D. Galasko et al., The Lewy body variant of Alzheimers disease: A clinical and pathologic entity,
Neurology 40 (1990), 18.
I.G. McKeith, R.H. Perry, A.F. Fairbairn, S. Jabeen and E.K.
Perry, Operational criteria for senile dementia of Lewy body
type (SDLT), Psychological Medicine 22 (1992), 911922.
H. Okazaki, L.E. Lipkin and S.M. Aronson, Diffuse intracytoplasmic ganglionic inclusions (Lewy type) associated with
progressive dementia and quadriparesis in flexion, Journal of
Neuropathology and Experimental Neurology 20 (1961), 237
244.
I. McKeith, Dementia with Lewy bodies: a clinical overview,
in: Dementia, A. Burns, O.B. JT and D A, eds, London:
Arnold, 2005.
J.S. Woodard, Concentric hyaline inclusion body formation
in mental disease: analysis of twenty-seven cases, Journal
of Neuropathology and Experimental Neurology 21 (1962),
442449.
R. Hassler, Zur pathologie der paralysis agitans und des
postenzephalitischen Parkinsonismus, Journal f.Psychologie
und Neurologie 48 (1938), 387476.
K. Kosaka, M. Yoshimura, K. Ikeda and H. Budka, Diffuse
type of Lewy body disease: progressive dementia with abundant cortical Lewy bodies and senile changes of varying degree A new disease? Clinical Neuropathology 3(5) (1984),
185192.
K. Kosaka, Lewy bodies in cerebral cortex. Report of three
cases, Acta Neuropathologica 42 (1978), 127134.
G. Lennox, J. Lowe, M. Landon, E.J. Byrne, R.J. Mayer and
R.B. Godwin-Austen, Diffuse Lewy body disease: correlative neuropathology using anti-ubiquitin immunocytochemistry, Journal of Neurology, Neurosurgery and Psychiatry 52
(1989), 12361247.
R. Perry, I. McKeith and E. Perry, Dementia with Lewy Bodies,
New York: Cambridge University Press, 1996.
I.G. McKeith, A.F. Fairbairn, R.H. Perry and P. Thompson,
The clinical diagnosis and misdiagnosis of senile dementia of
Lewy body type (SDLT), British Journal of Psychiatry 165
(1994), 324332.
O.L. Lopez, I. Litvan, K.E. Catt et al., Accuracy of four clinical diagnostic criteria for the diagnosis of neurodegenerative
dementias, Neurology 53 (1999), 12921299.
I. Litvan, A. MacIntyre, C.G. Goetz et al., Accuracy of the
clinical diagnoses of Lewy body disease, Parkinsons disease,
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
I.G. McKeith / Consensus guidelines for the clinical and pathologic diagnosis of dementia with Lewy bodies (DLB)
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
[50]
[51]
[52]
[53]
[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
423
425
1. Introduction
Alzheimers disease (AD) is a significant health
problem afflicting over 1% of the population in the
USA and costing $100 billion, roughly 7% of the US
health care costs. The expansion of human longevity
and increasingly aged population predicts large increases in patients with this late life disease. This will
be exaggerated when the demographic bulge known
as the baby boom skews population age distributions
over the next few decades. While palliative therapies
Corresponding author: Dave Morgan, Alzheimer Research Laboratory, MDC Box 9, University of South Florida, 12901 Bruce
Downs Blvd., Tampa FL, 33612 USA. Tel.: +1 813 974 3949; Fax:
+1 813 974 2565; E-mail: dmorgan@hsc.usf.edu.
may slightly delay institutionalization, disease modifying approaches to the treatment of AD are desperately
needed.
As discussed elsewhere in this volume by Hardy
(2005), one potential target for disease modifying therapies is the reduction of amyloid, material consisting
largely of the A peptide that accumulates in the brains
of Alzheimer patients. A variety of avenues to reduce
A deposition have been described, including reduction of A production, increasing the degradation of
the A peptide, dissolving the amyloid fibrils formed
from A, or enhancing the rate of A clearance from
the brain.
Immunotherapeutic approaches to disease modification have led to a number of successes. The only
disease that has been eliminated by modern medicine,
smallpox, was cured by a vaccine (200 years post-
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
426
Jenner). Vaccination is also closing in on a permanent cure for polio. Other forms of immunotherapy are
emerging. Monoclonal antibody therapy is maturing
with 16 FDA approved products such as Herceptin
and Remicade . Immunoconjugates and chimeric proteins such as Ontak and Etanercept are similarly
expanding the range of possibilities. Thus, experience
with active immunization with vaccines and passive immunization with monoclonal antibodies is increasingly
accepted as common medical practice. The question
is whether degenerative diseases of the CNS would be
tractable to the immmunotherapeutic approach.
sue, Chen et al. [6] demonstrated an amyloid associated learning and memory deficit in PDAPP mice using a working memory version of the open pool water
maze. As the mice aged, the deterioration of performance correlated with the amyloid loads in the individual mice, linking these two aspects of the amyloid
protein precursor (APP) mouse phenotype.
The active immunization against A used multiple inoculations over months to demonstrate effects in
transgenic mice. Part of the reason was the slow development of titers against A, requiring 23 boosts to
reach high levels using the Schenk et al. vaccination
regimen [8,11,25]. The question of whether passive
immunization could also benefit the cognitive deficits
in the transgenic mice was addressed in two papers in
2002. Both Dodart et al. [12] and Kotilinek et al. [20]
found that relatively short periods of anti-A antibody
injections could improve the learning and memory performance of APP transgenic mice. Importantly, these
improvements were found in the absence of detectable
changes in amyloid deposition. These data argued
that there was likely some pool of A, not readily detectable, that was most intimately linked to memory
disturbances and was reduced by the anti-A antibodies. Thus far the critical A pool has not been identified. Nonetheless, these data emphasize the potency of
the immunotherapeutic approach in reversing the APP
mouse behavioral phenotype.
427
428
Event
Anti-A antibodies catalytically disaggregate amyloid fibrils
A vaccine reduces amyloid deposition
Passive immunization with anti A antibodies reduces amyloid deposition; promotes phagocytosis
A vaccines protect amyloid depositing mice from memory deficits
2001
2001
2002
2003
2003
2003-05
Reference
Solomon et al. [39]
Schenk et al. [34]
Bard et al. [5]
Janus et al. [19]
Morgan et al. [27]
Bacskai et al. [2]
DeMattos et al. [9]
Dodart et al. [12]
Kotilinek et al. [20]
Orgogozo et al. [31]
Hock et al. [17]
Nicoll et al. [30]
Ferrer et al. [14]
Masliah et al. [23]
429
430
[2]
[3]
[4]
7. Conclusions
The attitudes towards immunotherapy for the treatment of AD have followed an emotional roller coaster.
The initial enthusiasm was deflated by the unexpected
adverse events in the clinical trial. However, the cognitive function data tantalize with suggestions that some
individuals have benefited from the treatment, in spite
of its abbreviated administration. Many approaches
are being investigated which might avoid the adverse
events associated with the active immunization trial.
Passive immunization approaches are attractive because of the greater control over the anti-A titers and
potential to terminate the therapy. However, mouse
data suggest that high anti-A titers might lead to increased congophilic angiopathy and vascular leakage.
Further trials of immunotherapy are already underway.
One involves passive immunization with an N-terminal
antibody. A second involves use of a truncated A peptide vaccine to minimize T cell responses. Obviously,
experience with the prior trial will dictate a cautious
approach to these further studies of immunotherapeutic intervention in AD. However, assuming these trials
continue to completion, they are likely to be the first
therapeutic evaluations of the amyloid hypothesis in
AD patients.
[10]
Acknowledgements
[11]
[12]
[5]
[6]
[7]
[8]
[9]
References
[1]
[13]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
431
432
[42]
433
Keywords: Amyloid-, site-directed antibodies, therapeutic chaperones, single-chain antibodies, EFRH sequence, immunomodulation
1. Introduction
Alzheimers disease (AD) is characterized by progressive loss of memory and cognitive function. AD
is beginning to approach epidemic proportions in the
industrialized world. It is estimated by the year 2025
there will be approximately 22 million cases of AD
worldwide, with at least 10 million being in the US
alone [1].
The pathology of AD is characterized primarily by
extracellular plaques and intracellular neurofibrillary
tangles. Plaques are composed mainly of the A pep-
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
434
Amyloid filaments, similar to those found in amyloid plaques and cerebrovascular amyloid, can be assembled from chemically synthesized A under welldefined experimental conditions in vitro, and the effect
on neural cells may be neurotoxic or neurotrophic, depending on the A fibrillar state [10]. In vitro amyloid formation is a complex kinetic and thermodynamic
process and the reversibility of amyloid plaque growth
in vitro suggests a steady-state equilibrium between A
in plaques and in solution [11]. The dependence of A
polymerization on peptide-peptide interactions to form
a -pleated sheet fibril and the stimulatory influence
of other proteins on the reaction suggest that amyloid
formation may be subject to modulation.
If so-called pathological chaperones like ApoE, heparan sulfate, increase the extent of A fibrils [12], we
proposed site-directed monoclonal antibodies against
A, which decrease A fibrils, as therapeutic chaperones [1315].
Antibody-antigen interactions involve conformational changes in both antibody and antigen that can
range from insignificant to considerable. Binding of
high affinity monoclonal antibodies (mAbs) to regions
of high flexibility and antigenicity may alter the molecular dynamics of the whole antigen [16,17]. Appropriate mAbs interact at strategic sites where protein aggregation is initiated, stabilizing the protein and preventing
further denaturation [18,19]. Experimental data show
that mAbs are able to stabilize the antigen by preventing
aggregation and resolubilizing already formed protein
aggregates [1820]. Such antibodies were found to stabilize the conformation of an antigen against incorrect
folding and recognize an incompletely folded epitope,
inducing native conformation in a partially unfolded
protein [20].
We demonstrated for the first time that antibodies
raised against the N-terminal region of A bind to pre-
The abundant evidence that A aggregation is an essential early event in AD pathogenesis has prompted an
intensive search for therapeutics that target A [6,23].
Several laboratories have bred AD diseased models of
transgenic mice that produce human A which develop
plaques and neuron damage in their brains, as recently
reviewed [24]. Even though they do not develop the
widespread neuron death and severe dementia seen in
the human disease they are used as models for the study
of AD.
Recently, the immunological concept in the treatment of conformational diseases has gained more attention, and immunization approaches are being pursued
in order to stimulate clearance of brain A plaques [25
28]. They include both active and passive immunization techniques. Active immunization approaches employ various routes of administration, types of adjuvants, the use of modified A epitopes and/or immunogenic A conjugates. Passive immunization approaches include monoclonal antibodies or specific antibody fragments directed against specific A epitopes.
These approaches, originated from various institutions
and companies, are systematically reviewed by B. Imbimbo [26].
4. Active immunization
We developed an immunization procedure for the
production of effective anti-aggregating A antibodies
based on filamentous phages displaying on their surface
the EFRH peptide as antigen. The EFRH sequence, encompassing amino acids 36 of the 42 residues of A,
was previously found to be the main regulatory site for
amyloid modulation and the epitope of anti-aggregating
435
Cell membrane
KPI
NH2
A
CHO
COOH
CHO
ISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKK
10D5,6C6,3D6
14C2
266, Amy33,1C2
80
% Protective effect
70
60
50
40
30
20
10
0
6C6
10D5
Amy33
1C2
14C2
mAb
Fig. 1. A: The full-length amyloid protein precursor (APP). The regions encompassing A as well as the sequence of EFRH are shown below.
The corresponding epitopes of the anti-A antibodies are underlined. B: Protective effect of monoclonal antibodies against A aggregation
induced by incubation of the peptide for 3 h at 37 C. Each percentage is related to maximal binding of each monoclonal antibody to A coated
onto ELISA plates in the absence of soluble A (100%) and calculated by comparison with the binding of the same mAbs to the residual soluble
A remaining after incubation at 37 C in the absence of the respective antibody [15].
antibodies [21,22]. Effective anti-aggregating antibodies were obtained by EFRH phage immunization, without adjuvant, in guinea pigs which exhibit the A sequence identical to that of humans [29,30]. Filamentous bacteriophages are a group of structurally related
viruses which contain a circular single-stranded DNA
genome. The phages that infect Escherichia do not kill
their host during productive infection and do not infect
mammalian cells. Sera of EFRH-phage immunized animals exhibited a protective effect in preventing Amediated neurotoxicity toward PC12 cell culture and
stained human amyloid plaques. Experiments in transgenic animals support the immunogenetic studies. In
two different sets of experiments, we immunized the
APP[V717I] transgenic mice (16 months old) with the
EFRH-phage and analyzed them at age 21 months [31].
Amyloid burden in the brain was significantly reduced
in the immunized APP[V717I] transgenic mice that
developed anti-A titers of at least 1:100, indicating
436
5. Passive immunization
Another set of experiments showed that peripheral
administration of antibodies against A was sufficient to reduce amyloid burden in the affected mice
brains [33]. The investigation confirmed that circulating antibodies were able to cross the blood brain barrier
and bind to brain A deposits. Despite their relatively
modest serum levels, the passively administered antibodies were able to enter the central nervous system,
decorate plaques and induce clearance of preexisting
amyloid.
Of the antibodies tested, only mAbs 10D5, 3D6 and
Pab A (1-42) directed to the N-terminal regions of
A demonstrated efficacy in vivo. In contrast, mAbs
16C11, 21F12 and the control antibody TM2a, directed
to other regions of A, were inactive. This result is
consistent with the inability of these two antibodies to
decorate plaques after in vivo administration and explains their inability to trigger plaque clearance. These
in vivo data confirm previous in vitro data [14] that only
antibodies directed to the strategic epitopes involved
in the aggregation process, such as EFRH, exhibit socalled chaperone-like properties in dissolving amyloid plaques.
Intravenous injection of mAb266 raised against middle region of A to the AD transgenic mice led to
a 1,000-fold increase in the concentration of A in
plasma. The researchers suggest that anti-amyloid antibody decreases A deposition, at least in part, by decreasing the transfer of A from plasma to the CNS and
increasing its transfer from the CNS to plasma without
dissolving existing amyloid plaques [34].
In order to overcome low permeability of the blood
brain barrier, we applied antibody engineering methods to minimize the size of the monoclonal antibodies
while maintaining their biological activity. The resulting scFvs can be displayed on the surface of a phage for
further manipulation or can be used as soluble ScFvs
( 25 kd) molecules.
We have previously shown that ScFvs raised against
A, which contained only variable regions of light and
heavy chains of the antibodies lacking the constant region Fc, exhibit anti-aggregating properties similar to
whole site-directed antibodies [35,36].
6. Concluding remarks
The immunological concept described in this study
was converted to a therapeutic strategy aimed at treatment of AD, as well as of other diseases caused by overproduction or wrong folding of a physiological,normal
peptide.
For any immunization strategy to be effective, it
needs not only to identify the specific nature of the antigen or of the epitope, but also to address the formulation and method of delivery of the antigen or antibodies
as a major and critical parameter.
Active immunization with synthetic A (1-42) peptide reduces A plaques in APP transgenic mice without detectable toxicity [38], but the extension of this
approach to AD patients induced a neuroinflammatory
reaction in some of the study subjects, precluding further testing with the preparation [39]. Vaccination with
non-toxic, small epitopes of A, such as EFRH, may
partially avoid the undesirable effects of neuroinflammation, e.g., by preventing T-cell activation.
On the other hand, humans may develop selfantibodies when immunized with whole or fragments
of A. These antibodies are capable of binding to a
variety of A species in the brain, thus, immunization
could have contradictory effects: the desired inhibition of amyloid fibril formation versus Fc microglial
over-activation leading to neuroinflammation [40].
Several strategies for prevention of neuroinflammation are under investigation. One of these is the administration of intravenous immunoglobulin (IVIG),
which has well-recognized anti-inflammatory activities
independent of the antigen-specific effect. A variety
of explanations have been put forward to account for
these activities, including Fc receptor blockade, attenuation of complement-mediated tissue damage, downregulation of B cell responses, etc. [41].
Another approach could be passive immunization
with antibodies devoid of Fc, which might prevent
[16]
[17]
[18]
[19]
[20]
References
[21]
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
L.E. Hebert, L.A. Beckett, P.A. Scherr and D.A. Evans, Annual
incidence of Alzheimer disease in the United States projected
to the years 2000 through 2050, Alzheimer Dis. Assoc. Disord.
15 (2001), 169173.
D.J. Selkoe, The molecular pathology of Alzheimers disease,
Neuron 6 (1991), 487498.
J. Busciglio, A. Lorenzo, J. Yeh and B.A. Yankner, -amyloid
fibrils induce tau phosphorylation and loss of microtubule
binding, Neuron 14 (1995), 879888.
J. Hardy, K. Duff, K.G. Hardy, J. Perez-Tur and M. Hutton,
Genetic dissection of Alzheimers disease and related dementias: Amyloid and its relationship to tau, Nat. Neurosci. 1
(1998), 355358.
D.J. Selkoe, Amyloid protein and the genetics of
Alzheimers disease, J. Biol. Chem. 271 (1996), 1829518298.
J. Hardy and D. Selkoe, The amyloid hypothesis of
Alzheimers disease: progress and problems on the road to
therapeutics, Science 297 (2002), 353356.
M.C. Chartier-Harlin, F. Crawford, H. Houlden, A. Warren, D.
Hughes, L. Fidani, A. Goate, M. Rossor, P. Roques, J. Hardy
and M. Mullan, Early-onset Alzheimers disease caused by
mutations at codon 717 of the beta-amyloid precursor protein
gene, Nature 353 (1991), 844846.
E. Levy-Lahad, W. Wasco, P. Poorkaj, D.M. Romano, J. Oshima, W.H. Pettingell, C.E. Yu, P.D. Jondro, S.D. Schmidt, K.
Wang et al., Candidate gene for the chromosome 1 familial
Alzheimers disease locus, Science 269 (1995), 973977.
M.N. Sabbagh, D. Galasko and L.J. Thal, -Amyloid and
treatment opportunities for Alzheimers disease, Alzheimers
Disease Review 3 (1998), 119.
A. Lorenzo and B.A. Yankner, Beta-amyloid neurotoxicity
requires fibril formation and is inhibited by Congo red, Proc
Natl Acad Sci USA 1 (1994), 1224312247.
J.E. Maggio and P.W. Mantyh, Brain amyloid A physicochemical perspective, Brain Pathol 6 (1996), 147162.
T. Wisniewski, E.M. Castano, A. Golabek, T. Vogel and B.
Frangione, Acceleration of Alzheimers fibril formation by
apolipoprotein E in vitro, Am J Pathol 145(5) (1994), 1030
1035.
B. Solomon, R. Koppel, E. Hanan and T. Katzav, Monoclonal antibodies inhibit in vitro fibrillar aggregation of the
Alzheimers -amyloid peptide, Proc. Natl. Acad. Sci. USA
93(1) (1996), 452455.
B. Solomon, R. Koppel, D. Frankel and E. Hanan-Aharon,
Disaggregation of Alzheimer -amyloid by site-directed mAb,
Proc. Natl. Acad. Sci. USA 94 (1997), 41094112.
E. Hanan and B. Solomon, Protective effect of monoclonal
antibodies against Alzheimers -amyloid aggregation, Amyloid: Int. J. Exp. Clin. Invest. 3 (1996), 130133.
[22]
[23]
[24]
[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]
[33]
[34]
437
438
[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
439
Abstract. The story of the development of tacrine began from its synthesis
as an intravenous antiseptic in 1940 by Adrian Albert in Australia. In the
1970s William Summers began using tacrine in treating drug overdose coma
and delirium. He felt it might have application in Alzheimers based on work
done in England by Peter Davies. In 1981, Summers et al. gave intravenous
tacrine to Alzheimers patients showed measurable improvement. Between
1981 and 1986, Summers worked with Art Kling and his group at UCLA to
demonstrate usefulness of oral tacrine in treatment of Alzheimers patients.
The average length of tacrine use in 14 completing patients was 12.6 months
and improvement was robust. This sparked controversy in the field. In 1993,
after larger studies replicated the positive effect of tacrine, it was approved by
the US Food and Drug Administration for treatment of Alzheimers disease.
1. Introduction
In 1975, as a psychiatric resident at Washington
University (St. Louis), my interest was anticholinergic
delirium [33,34,39,40]. Dr. Robert N. Butler from the
National Institute of Aging, at a grand rounds that year,
raised the possibility that senile dementia could be the
same disease as pre-senile Alzheimers dementia [4].
This hypothesis was based on work by Dr. Robert D.
Terry [45].
My work centered around a theory that cholinergic
system dysfunction was the final common pathway to
delirium (acute brain syndrome). This was fueled by
Granacher and Baldessarinis discovery that tricyclic
antidepressant overdose coma could be reversed by the
acetylcholinesterase inhibitor, physostigmine [12].
The text was carefully edited by Ray Faber, M.D., Department
of Psychiatry, University of Texas San Antonio. This work was
supported by Solo Non-Profit Research Ltd.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
440
441
Fig. 1.
patient given intravenous tacrine. A makeshift concoction was devised. This was phosphatidyl choline
in large quantity with ophthalmic pilocarpine taken
by mouth. My belief was and continues to be that
Alzheimers disease is complex. It requires a combination chemotherapy approach, much as tuberculosis or
cancer does.
Also in spring of 1982, I was approached by Art
Cherkin, Ph.D. He was a neurophysiologist at UCLA
who championed the concept pharmaceutical synergy
in cholinergic systems. He encouraged me to resume
my research with tacrine. He did not view my position as a private practice physician as a problem. Dr.
Cherkin introduced me to the Art Kling, M.D., who
was the chairman of psychiatry at the Sepulveda VA
Hospital, a division of UCLA. Dr. Kling offered me a
position on the clinical faculty at UCLA. First thoughts
of oral tacrine treatment of Alzheimers disease (AD)
began.
George Rehnquist would report in monthly about
his wife. He always asked if tacrine could be given
by mouth. Mr. Rehnquist began calling the FDA and
would ask them how his wife could receive oral tacrine.
Maurice Albin, M.D., an anesthesiologist of my acquaintance at the University of Pittsburgh had told me
once that tacrine could be absorbed orally [2]. Several
faculty members at the Sepulveda VA, helped me prove
this point.
Dr. Kling arranged for animal absorption and safety
data to be developed in two species (mice and primates) [16,23]. This and other data were submitted to
the FDA to amend my IND for tacrine. Bulk tacrine
was manufactured by Aldrich Chemical Company in
442
443
average length of tacrine use in the fourteen completing patients was 12.6 months. This was quite a robust
duration of study for the initial report of a treatment. It
was felt appropriate, because tacrine had potential for
long term hepatic, hematologic and neurologic toxicity.
Lengthy observation on the drug was desirable. Permitting any other drug necessary to optimize health actually allowed observation of drug-drug interactions on
a small population of patients. This minimized Vioxxlike surprises [49]. With this method, it was hoped
that even a small study, would discovered the major
adverse effects of tacrine. Indeed tacrine has now been
used on a daily basis in over 300,000 patients with less
than 5 deaths [32,41]. The design of inclusion of other
drugs then allowing the patient to be their own control
seemed effective in ferreting out adverse effects.
Reaction of researchers in the field was often negative. For example:
There is a scientific rationale behind THA, says
Dr. Leon Thal, a researcher at San Diego Veterans
Administration Hospital. But the results are overwhelming, and when you get results like that out of
the blue, the first reaction is to be skeptical. [46].
And skeptical they were.
Subsequent to the November 1986 article, the NEJM
permitted publication of five of the six letters received
from its vast readership [38]. All were from prominent
researchers in the field. All were critical. The subsequent multicenter study, excluded my group. Instead
investigation in detail of our research by the FDA and
by UCLA was precipitated by researchers in the field.
These investigations and restrictions by FDA minimized expansion of our work. Ultimately the integrity
of the research was confirmed [9,25]. On March 28,
1989 the US patent on tacrine was issued. Tacrine now
had a 17 year market value [29]. Eighteen months later
the pharmaceutical company that sponsored the multicenter studies of tacrine, took a license on the patent by
means of a hostile litigation against me. Four pivotal
studies showed tacrine to be safe and effective [6,10,
17,48].
On September 10, 1993, tacrine became the first FDA
approved treatment for Alzheimers disease [47]. The
post-market experience with tacrine has been that it is
much more benign that the FDA publicly proclaimed it
to be [31].
Today there are five FDA approved treatments for
Alzheimers disease. Four are anticholinesterases
tacrine (Cognex ), donepezil (Aricept ), rivastigmine
(Exelon ) and galantamine (Reminyl ); and the first
NMDA receptor antagonist memantine (Namenda ).
444
Since the discovery of tacrine, the field of Alzheimers disease has focused much attention on the cause
of the illness. Focus has been on amyloid beta-peptide
as causal [13]. The competing theory has been Tau
protein [44]. Much has been learned about the brain
in the amyloid beta and tau protein research. To me
neither of these theories seemed logical. Senile plaques
and neurofibrillary tangles always struck me as tombstones derived from cellular debris. It is refreshing
then to seen a shift toward new theories of etiology of
Alzheimers [19,24].
Looking to the future, I believe the oxidative injury
theory will be able to explain both amyloid-beta and
tau protein theories. The oxidative injury theory points
to available treatments and the possibility to prevent
Alzheimers altogether [30].
I must give much credit for my story to many of
the above referenced people. I most especially wish
to credit Art Kling, Art Cherkin, and Ken Tachiki for
inspirations, support and assistance [3].
Much credit for the tacrines survival of the gauntlet
must be given to The Wall Street Journal. The late
Robert Bartley and his colleague Daniel Henninger,
saw the importance in protecting tacrine, and penned
a compelling set of editorials. These editorials which
defended tacrine, were a risk. The risk paid off. Work
on tacrine continued. The Bartley-Henninger risk has
lead to the wide acceptance that neurodegenerative illness can be treated. Today there are five FDA approved
treatment of Alzheimers disease and the future looks
very hopeful.
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
References
[1]
[2]
[3]
[4]
[5]
[6]
A. Albert, The acridines; their preparation, physical, chemical, and biological properties and uses, Edward Arnold &
Co., London, 1951.
M.S. Albin, L. Bunegin, Massopust and P.J. Jannetta,
Ketamine-induced postanesthetic delirium attenuated by
tetrahydroaminoacridine, Exp Neurol 44(1) (1974), 126129.
and personal communications.
Art Cherkin died in 1990 before his work really became well
known. Art Kling died in 1998 in time to see much of his years
of effort come to fruition. Ken Tachiki, my friend the dreamer,
died in December, 2004. Robert Bartley, distinguished editor
of The Wall Street Journal died in 2004. All are much missed.
R.N. Butler, Mission of the National Institute on Aging, J Am
Geriatr Soc 25(3) (1977), 97103.
P. Davies and A.J. Maloney, Selective loss of central cholinergic neurons in Alzheimers disease, Lancet 2 (1976), 1403.
K.L. Davis, L.J. Thal, E.R. Gamzu, C.S. Davis, R.F. Woolson,
S.I. Gracon, D.A. Drachman, L.W.S. Schneider, P.J. Whitehouse, T.M. Hoover, J.C. Morris, C.H. Kawas, D.S. Knopman,
N.L. Earl, V. Kumar and R.S. Doody, A double-blind placebo
[19]
[20]
[21]
[22]
[23]
[24]
[25]
controlled multicenter study of tacrine for Alzheimers disease. The tacrine collaborative study group, N Engl J Med 327
(1992), 12531259.
I.S. De La Lande and G.A. Bentley, The action of morphine
and antagonists of the narcotic action of morphine on acetylcholine synthesis in brain, Aust J Exp Biol Med Sci 33 (1955),
55559.
J.A. DiMasi, R.W. Hansen and H.G. Grabowski, Assessing
claims about the cost of new drug development: a critique
of the Public Citizen and Tuberculosis Alliance reports. Tufts
Center for the Study of Drug Development, Tufts University,
November 1, 2004.
Editorial. Dr. Summers Victory. WSJ 25 May 1989; A16.
M. Farlow, S.I. Gracon, L.A. Hershey, K.W. Lewis, C.H.
Sandowsky and J. Dolan-Ureno, A controlled trial of tacrine
in Alzheimers disease: the tacrine study group, JAMA 268
(1992), 25232529.
S. Gershon, Behavioral effects of anticholinergic psychotomimetics and their antagonists in man and animals, Rec
Adv Biol Psychiat 13 (1966), 151.
R.P. Granacher and R. Baldessarini, Physostigmine its use
in acute anticholinergic syndrome with antidepressant and antiparkinson drugs, Arch Gen Psychiat 32 (1975), 375380.
C. Haass and D. Selkoe, Alzheimers disease. A technical KO
of amyloid-beta peptide, Nature 391 (22 Jan 1998), 339340.
G. Irving, R.A. Robinson and W. McAdam, The validity of
some cognitive tests in the diagnosis of dementia, Brit J Psychiatry 117 (1970), 149156.
P.N. Kaul, Enzyme inhibiting action of tetrahydroaminoacridine and its structural fragments, J Pharm Pharmacol 14
(1962), 243245.
A. Kling, L.J. Fitten, K. Perryman and K. Tachiki, Oral Tacrine
Administration in Middle Aged Monkeys: Effect on Discrimination Learning, Soc for Neurosci Annual Meeting (20 October 1985), abstract No. 114.7.
M.J. Knapp, D.S. Knopman, P.R. Solomon, W.W. Pendlebury,
C.S. Davis and S.I. Gracon, A thirty week randomized controlled trial of high-dose tacrine in patients with Alzheimers
disease: the tacrine study group, JAMA 271 (1994), 985991.
S.E. Lind, Fee-for-service research, N Engl J Med 314 (1986),
312315.
M.E. Obrenovich, J.A. Joseph, C.S. Atwood, G. Perry and
M.A. Smith, Amyloid-beta: a (life) preserver for the brain,
Neurobiology of Aging 23 (2002), 10961099.
T.H. Park, K.H. Tachiki, W.K. Summers, D. Kling, J. Fitten,
K. Perryman, K. Spidel and A.S. Kling, Isolation and the fluorometric high-performance liquid chromatographic determination of tacrine, Anal Biochem 159 (1986), 358362.
E.K. Perry, B.E. Tomlinson, G. Blessed, K. Bergmann, P.H.
Gibson and H.R. Perry, Correlation of cholinergic abnormalities with senile plaques and mental test scores in senile dementia, Brit Med J ii (1978), 14571459.
D. Pressman, Patent It Yourself, (1st ed.), Nolo Press: Berkeley, CA, 1985.
A. Rashti, S. Childers, K. Tachiki, C. Melchior, A. Steinberg and R.F. Ritzmann, Alterations in response to ethanol by
tacrine and physostigmine, Soc Neurosci (1988), Abstract 14.
C.A. Rottkamp, A.K. Raina, X. Zhu, E. Gaieve, A. Bush, C.S.
Atwood, M. Chevion, G. Perry and M.A. Smith, Redox active
iron mediated amyloid beta toxicity, Free Radical Biology and
Medicine 30 (2001), 447450.
J. Scott, Alzheimer prober partly vindicated by UCLA panel,
Los Angeles Times (9 Aug 1988), A3.
[28]
[29]
[30]
[31]
[32]
[33]
[34]
[35]
[36]
[37]
[38]
F.H. Shaw and G.A. Bentley, Pharmacology of some anticholinesterases, Aust J Exp Biol Med Sci 31 (1953), 573576.
T. Sjogren, H. Sjogren and A.G.H. Lindgrend, Morbus
Alzheimer and morbus pick, Acta Psychiat Neurol Scand
82(Suppl) (1953), 1152.
W.K. Summers, A clinical method of estimating risk of drug
induced delirium, Life Sciences 22 (1978), 15111516.
W.K. Summers, Administration of monoamine acridines in
cholinergic neuronal deficit states. United States Patent No.
4,816,456.
W.K. Summers, Alzheimers disease, oxidative injury, and
cytokines, J Alz Dis 6 (2004), 651657.
W.K. Summers, Fee-for-service research on THA: an explanation, N Engl J Med 316 (1987), 16051606.
W.K. Summers, Tacrine (THA, Cognex ), J Alzheimers Dis
2 (2000), 8593.
W.K. Summers, Psychiatric sequellae to cardiotomy, J Cardiovascular Surg 20 (1979), 471476.
W.K. Summers, R.E. Allen and F.N. Pitts, Does physostigmine
reverse quinidine delirium? West J Med 135 (1981), 411414.
W.K. Summers, V.L. DeBoynton, G.M. Marsh and L.J. Majovski, Comparison of seven psychometric instruments used
for evaluation of treatment effect in Alzheimers disease, Neuroepidemiology 9 (1990), 193207.
W.K. Summers, K.R. Kaufman, F. Altman and J.M. Fischer,
THA-A review of the literature and its use in treatment of five
overdose patients, Clin Toxicol 16 (1980), 269281.
W.K. Summers, L.V. Majovski, G.M. Marsh, K. Tachiki and
A. Kling, Oral Tetrahydroaminoacridine in Long-term Treatment of Senile Dementia, Alzheimer Type, N Engl J Med 315
(1986), 12411245.
W.K. Summers, L.V. Majovski, G.M. Marsh, K.H. Tachiki
and A. Kling, Oral tetrahydroamino acridine in the treatment
of senile dementia Alzheimers type: Response to six letters
to the Editor, N Engl J Med 316 (1987), 16031605.
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]
[49]
445
447
Keywords: Cholinergic basal forebrain, Alzheimer disease, neuropathology, drug development, quality of life, bioethics, cognitive
science
1. Introduction
The quality of our lives depends more on serendipity
than most of us care to admit. Such is also true of
the quality of ones academic career. In the 1980s, I
was fortunate enough to be in the right place, with the
right people, at the right time, using the right methods to ask a question about the biological substrate of
the cognitive impairment of Alzheimers disease (AD).
Corresponding author: Peter J. Whitehouse, MD, PhD, Professor,
Neurology, Case Western Reserve University, 12200 Fairhill Road,
Suite C357, Cleveland, OH 44120-1013, USA. Tel.: +1 216 844
6448; Fax: +1 216 844 6466; E-mail: peter.whitehouse@case.edu.
ISSN 1387-2877/06/$17.00 2006 IOS Press and the authors. All rights reserved
448
P.J. Whitehouse / Quality of life: The bridge from the cholinergic basal forebrain to cognitive science and bioethics
P.J. Whitehouse / Quality of life: The bridge from the cholinergic basal forebrain to cognitive science and bioethics
449
450
P.J. Whitehouse / Quality of life: The bridge from the cholinergic basal forebrain to cognitive science and bioethics
ing AD. Find a cure became the goal, if not the obsession, of the field. Attention to the softer, human
aspects of providing care was relatively neglected. I
became increasingly concerned about the very way we
conceptualize diseases like AD. Medicine- both in general and in the Alzheimers field intensified its attraction to for-profit models of research and the process of
commercialization intensified. Between the time of our
original work on the NBM and the approval of the last
drug for AD working with industry moved from being
viewed as a necessary evil beneath the dignity of many
academics to a competitive arena to see who could
make the most money by starting their own company or
consulting with big pharmaceutical companies. Moreover, federal legislation (like Baye-Dole) began a process of undermining the very integrity of universities as
relatively more independent bastions of social criticism
and pursuit of knowledge. As marketing monies entered the scene, physicians found increasing conflict of
interests between their professional responsibilities for
putting patient concerns first and enhancing personal
and organizational financial well-being.
In the basic science arena, systems neuroscience,
once the dominant methodology aligned with interest in clinical/pathological studies and interests in
brain/behavior correlations, was replaced by molecular biology and genetic approaches. Attention in the
trial arena shifted from developing drugs to improve
symptoms, to drugs to prevent and even cure the disease. Gene therapies, neural transplants and stem cells
became the hypes, if not the hopes, for the future. I
felt that current drugs and future research promised
too much benefit to individuals and society. Direct-toconsumer advertising created not only a demand from
patients for more expensive, less studied and hence less
safe drugs, but also contributed to creating the very diseases from which the consumer/patient allegedly suffered in the first place. The current outpouring of concern about the power of the pharmaceutical industry,
particularly in its role as a global multinational agent,
is long overdue.
In the mid 1990s I left the laboratory for good,
stepped down as director of Cases Alzheimer Center
and steered increasingly to organizational and ethical
concerns. I began to focus my NIH funded research,
working with such groups as the IWGH and the National Institute on Aging Alzheimers Disease Cooperative Study, on the concept and measurement of quality of life and ethical issues, such as informed consent in research and genetic testing [2022]. After all,
developing trustworthy information about how to im-
prove quality of life appears to be the goal that everybody seeks, from affected persons and their families to
molecular biologists and policy-makers. We tried to
raise the stakes for anti-dementia drugs by asking for
evidence not just for efficacy in trials but for effectiveness in practice. Moreover, I came to realize that nonbiological interventions might have more profound effects on quality of life than drugs. As a result I became involved in national and local initiatives involving daycare, special care units, hospice and educational
approaches. Eventually, I focused more on narrative
approaches to address the cognitive challenges of aging. How could the power of stories be used to heal
and relieve the suffering of those with cognitive impairment? How could multimedia approaches aid memory through reminiscence and hence improve quality of
life in families affected by AD? Could advance directives, important to guiding end-of-life care, be supplemented by diary, scrap book approaches? How could
computers assist caregivers? Eventually I developed
with my wife and others, my most interesting organizational response to the cognitive challenges of aging.
We founded The Intergenerational School, the first ever
public community school based on multi-age real-life
learning in community, to foster positive responses to
the impairment of memory and other cognitive abilities that affect us all to one degree or another as we
age. Persons with memory impairment read and garden with children from urban Cleveland attending our
public school.
The excessive claims of molecular biology-driven,
Nobel prize seeking, profit-driven scientists further
turned me away from what I was coming to see as
problematic lines of research and an uninhibited faith
in the power of basic biological research. I returned
in my memory to our earlier studies of the NBM and
nicotinic receptors and recounted that some cell and
receptor losses occurred in intellectually intact (or relatively so) normal, older individuals. I also reflected
upon Oprahs penetrating question about the alleged
differences between senility and AD.
Where does one draw the line between aging and disease I wondered? I worked on developing criteria for
Aging-Associated Memory Impairment [23] and Aging Related Cognitive Decline [24]. I was linked to,
but not directly involved in the American Association
of Neurologys effort to develop guidelines for early
recognition of AD. Ron Petersen (Mayo Clinic) led the
effort to consider early diagnosis in AD in such a way
that it would intensify the reification of his concept of
mild cognitive impairment (MCI). Such a label threat-
P.J. Whitehouse / Quality of life: The bridge from the cholinergic basal forebrain to cognitive science and bioethics
451
lems today and increasingly so in the near future. Ironically, my training in bioethics opened my eyes to the
enormity of the moral issues facing our species, and
also to the limits of a narrowly construed,academicallyoriented biomedical ethics. Bioethics as envisioned by
the man who coined the term, Van Rensselaer Potter,
had a more global, spiritual and activist, dare I say
deeper, agenda [30]. Based on the land ethic of Aldo
Leopold, Potter advocated for bioethics as a bridge between science and the humanities and medicine and
public health. Deterioration of our environment and
challenges to our species to preserve the diversity of life
cannot be corrected through mere genetic manipulations or pharmaceutical developments. Will our legacy
be the decimation of our planet and the blood of countless other life forms on our hands?
How do we prioritize the challenges of what we
now call AD in this more global picture in which the
health and wellbeing of children and future generations around the world are increasingly threatened every day? Can we reframe AD so as to go beyond just
being critical of the molecular hype that produces false
hope through the promise of a pharmaceutical panacea?
Can we offer a positive vision of an achievable future
that we can create together? I think we can and I am
trying in my own life, in my practice as a healer, and
in my academic scholarship to address ways of reframing the challenges of cognitive aging. My approaches
involve constructing different narratives for our individual and collective lives than currently exist. Such
stories can celebrate learning about the brain and our
genetic make-up. However, such future stories must
also address priorities such as the fate of younger generations, especially their ability to gain an education
and be productive citizens. Any minor or even major
step towards a cure for the diseases of brain aging
should not devalue caring as we do today in the AD
field. We are all human beings living on the same planet
who age and die. We must develop a global bioethic,
not a narrow superficial bioethics like the one that currently dominates medicine. This global bioethic must
include a concern for social justice and sustainability
of diversity of life [30].
Reframing our conceptions of AD will be an essential part of this effort to create a sustainable society for
the future. We are all on a trajectory towards some
degree of memory loss as we age. Some will live long
enough to outlive their brains capacity to operate in
the world. Some (even some with memory problems)
will live long enough to contribute to intergenerational
learning and share stories that celebrate life and learn-
452
P.J. Whitehouse / Quality of life: The bridge from the cholinergic basal forebrain to cognitive science and bioethics
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
References
[18]
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[19]
[20]
[21]
[22]
[23]
[24]
[25]
P.J. Whitehouse / Quality of life: The bridge from the cholinergic basal forebrain to cognitive science and bioethics
[26]
[29]
453
455
Keyword Index
A
309
A oligomers
123
APP
91, 133, 381
APP mutations
389
abnormally hyperphosphorylated tau
219
AD
309
Alzheimer disease
61, 71, 171, 195, 367, 425, 447
Alzheimers disease
29, 53, 79, 91, 133, 163
177, 277, 329, 381, 389, 409
Alzheimers neurofibrillary changes
53
amyloid
91
Amyloid
329, 341
Amyloid -protein
163
Amyloid -protein precursor
329, 341
Amyloid-
133, 277, 425, 433
APOE
381
apoptosis
277
APP
163, 367
autophagy
277
bioethics
biomarkers
447
409
cathepsin
cerebral amyloid angiopathy (CAA)
cerebral hemorrhages
cholinergic basal forebrain
clinico-pathological correlations
cognition
cognitive science
complement
conformational diseases
cortical minicolumns
cyclin-dependent protein kinase-5
277
329, 389
389
447
61
101
447
271
319
79
219
dementia
dementia disorders
dementia with Lewy bodies
diagnosis
diagnostic accuracy rates
diagnostic criteria
389, 409
61
417
409, 417
61
409
diagnostic instruments
drug development
drug discovery
Dutch type (HCHWA-D)
409
447
163
329
EFRH sequence
endocytosis
endosome
433
277
277
341
389
gene
genetics
glycogen synthase kinase-3
GSK-3
341, 381
367
219
309
HCHWAD
389
hereditary cerebral hemorrhage with amyloidosis 329
Herpes simplex virus
29
hippocampus
29
immunization
immunohistochemistry
immunomodulation
indomethacin
133
271
433
271
limbic
101
MAP1
MAP2
MCI
membrane attack complex
memory
mice
microtubule assembly
microtubules
mild cognitive impairments
molecular misreading
morphometry
Morris water maze
ISSN 1387-2877/05/$17.00 2006 IOS Press and the authors. All rights reserved
219
219
409
271
123
123
219
177, 257
409
319
29
123
456
mutation
National Institute on Aging
necrosis
neocortex
neural plasticity
neurofibrillary tangles
neuroimaging
neuropathology
neuropil threads
NFT
NIA
NIH
NSAID
olfactory system
operant behavioral task
Keyword Index
protein phosphatase-2A
219
quality of life
447
rats
reactive microglia
123
271
secretases
self-assembly of tau
single-chain antibodies
site-directed antibodies
synapse
synapse loss
synaptic plasticity
synucleinopathies
163
219
433
433
101
91
91
319
tau
71, 171, 195, 219, 257, 367, 373
tau proteins
177
tauopathy
309, 319, 373
taxol
257
therapeutic
133, 425
therapeutic chaperones
433
topographic study
53
transgenic
123, 425
transgenic mice
133
ultrastructure
101
vaccine
vasopressin
425
319