Concise Eurocodes: Geotechnical Design: BS EN 1997-1: Eurocode 7, Part 1
Concise Eurocodes: Geotechnical Design: BS EN 1997-1: Eurocode 7, Part 1
Geotechnical design
Brian Simpson
First published in the UK in 2011
by
BSI
389 Chiswick High Road
London W4 4AL
All rights reserved. Except as permitted under the Copyright, Designs and Patents
Act 1988, no part of this publication may be reproduced, stored in a retrieval system
or transmitted in any form or by any means – electronic, photocopying, recording
or otherwise – without prior permission in writing from the publisher.
Whilst every care has been taken in developing and compiling this publication, BSI accepts
no liability for any loss or damage caused, arising directly or indirectly in connection with
reliance on its contents except to the extent that such liability may not be excluded in law.
The author’s commentary demonstrates the best in current thinking from a leading
authority on Eurocodes, but it represents strictly the personal opinion of the author
rather than official British Standards guidance. BSI accepts no liability for any loss
or damage caused arising directly or indirectly in connection with reliance on its
content, except to the extent that such liability may not be excluded in law.
BSI has no responsibility for the persistence or accuracy of URLs for external or
third-party internet websites referred to in this book, and does not guarantee that
any content on such websites is, or will remain, accurate or appropriate.
The right of Brian Simpson to be identified as the author of this Work has been asserted by him
in accordance with sections 77 and 78 of the Copyright, Designs and Patents Act 1988.
ISBN 978-0-580-75271-1
Preface
1. Purpose
This book is intended to assist geotechnical designers by providing a reduced version of BS EN 1997-1
(EC7) together with added commentary by the author (which is differentiated from the Eurocode text
by means of grey shading), giving explanations where the text could be found difficult to understand
or to apply. It has been developed particularly for the use of engineers who are experienced in
geotechnical design but want a quicker way to understand the procedures required by EC7. It is
intended to aid use of EC7, rather than to provide background explanation.
Starting from the original text of BS EN 1997-1, material that is not needed in common design
situations has been omitted. Omissions are marked by ** and the headings and numbering of EC7 is
retained throughout. Cross-references have been added to other Euronorms, and to other documents,
including those published by BSI, quoting text or tables of values from other Euronorms where this is
helpful. All additions to EC7 are shown in shaded boxes.
The text of EC7 contains many checklists. For ease of use, these have been removed to Appendix 2 and
arranged as forms for practical use.
This book also contains the most commonly needed content of the United Kingdom National Annex
(UKNA) to EC7. In particular, Annex A of the European (CEN) version of EC7, which provides the values
of partial factors, is replaced by the equivalent annex taken from the UKNA.
Designs for common situations based on this book will generally conform to EC7. However, full
conformance to the Eurocode can only be ensured by careful use of the complete version of
BS EN 1997-1 and its National Annex.
2. Geotechnical design
The subject of EC7 is ‘Geotechnical design’. In this context, a good definition of ‘design’ is ‘the process
of decisions that determines what will be built’. The Eurocodes are particularly concerned with final
design, which governs safety, and not so much with scheme designs and the preliminary designs
used for the purposes of costing and tendering. Thus the Eurocodes provide a series of tests that the
structure that is finally to be built is required to pass.
The essence of limit state design is to set up ‘design situations’, which in some cases might be quite severe,
and then to show that relevant limit states would not be exceeded if those situations were to occur.
For the typical designs considered by this book, the designer is required to consider ultimate limit state
(ULS) and serviceability limit state (SLS) situations.
1.5.2.12
limit states
states beyond which the structure no longer fulfils the relevant design criteria
1.5.2.13
ultimate limit states
states associated with collapse or with other similar forms of structural failure
1.5.2.14
serviceability limit states
states that correspond to conditions beyond which specified service requirements for a structure or
structural member are no longer met
These definitions are essentially non-technical. Ultimate limit states generally involve danger of
casualties or severe economic loss. Serviceability limit states are less serious, involving inconvenience
or disappointment, and any damage is often repairable. More detailed descriptions of ultimate and
serviceability limit states are given in BS EN 1990, clauses 3.3 and 3.4. EC7 clause 2.4.7.1 notes five
types of ULS relevant to geotechnical design.
Calculations for both ULS and SLS are carried out using design values of the parameters defining
actions, materials, resistances and geometry. These are generally pessimistic values, incorporating all
necessary factors or margins of safety, so that no further overall factor of safety is required. The design
values for ULS and SLS will usually be different, generally more pessimistic for ULS since the occurrence
of such a limit state would be a more serious event. The term design value as used in the Eurocodes is
quite different from the traditional British usage of, for example, a design load, which would usually
mean an unfactored load.
Most commonly, design values are derived by applying partial factors γ to characteristic material
strengths or resistances, and to representative actions. In principle, this applies to both ULS and SLS
calculations but, generally, all the values of γ for SLS are 1.0. Details of the application of γ factors can
be found in 2.4.6 and 2.4.7. Direct assessment of design values is also allowed, in which the designer
assesses a suitably pessimistic value without the use of factoring, as discussed under 2.4.6.
Characteristic values of geotechnical parameters are discussed further under 2.4.5.2. Representative
values of actions are derived from characteristic values by applying load combination factors, as
explained in BS EN 1990, Section 4.
The partial factor method was originally introduced in order to provide more consistent safety for a
wide range of situations in which various parameters – actions (loads) and the way they combine,
material properties, geometry – could be the dominant uncertainties in terms of their effects on
overall safety. It is also thought that the method gives more opportunity for rational variation and
development in situations where these uncertainties are unusually large or small.
The values of partial factors have not been chosen to allow for major uncertainty or systematic
inaccuracy of calculation methods. Rather, it is required that all calculation methods are either accurate
or err on the side of safety [2.4.1(6) to (9)].
Eurocodes are implemented as standards by national standards bodies. When using them, it is
therefore important to use the appropriate national annex, which will usually be the national annex of
the nation in which the construction site is located. Alternatively, the national annex to be used could
be specified by contracts, depending on the legal constraints of each nation. The United Kingdom
National Annex, published by BSI, will be referred to as the UKNA.
For the UK, a letter sent by the Department for Communities and Local Government to building control
offices and others can be seen at http://www.communities.gov.uk/documents/planningandbuilding/
pdf/1454859.pdf. This gives formal notification that Eurocodes are available for building control
purposes and that the UKNA is to be used for construction in the UK. The letter also announces that
some British Standards are withdrawn from 31 March 2010. Annex A states correctly that BS 8002 and
BS 8004 are withdrawn but also states that BS 8006 and BS 8081 are withdrawn, which is not correct.
The term ‘withdrawn’ means that BS 8002 and BS 8004 are no longer current British Standards and
they will not be maintained further. It does not prevent their use in design but this could be open to
the objection that they are no longer current.
If Eurocodes are used in non-European countries, it is important to establish which national annex is
to be applied. Use of the CEN ‘recommended values’ (CEN default values) is strongly discouraged,
especially for pile design, for which more conservative values have been specified by most countries.
Preface ix
Foreword to EN 1997-1 xiii
Section 1 General 1
1.1 Scope 1
1.2 Normative references 2
1.3 Assumptions 2
1.4 Distinction between Principles and Application Rules 2
1.5 Definitions 3
1.6 Symbols 5
Section 8 Anchorages 70
Section 12 Embankments 93
Annex A (normative) Partial and correlation factors for ultimate limit states and
recommended values 94
Annex D (informative) A sample analytical method for bearing resistance calculation 102
Annex G (informative) A sample method for deriving presumed bearing resistance for
spread foundations on rock 109
Bibliography 165
1.1 Scope
(2) EN 1997 is intended to be applied to the geotechnical aspects of the design of buildings and civil
engineering works.
**
Section 1: General
Section 8: Anchorages
— in A: recommended partial factor values; different values of the partial factors may be set by the
National annex;
— in B to J: supplementary informative guidance such as internationally applied calculation methods.
This clause provides references to the other Eurocodes and some of the geotechnical execution
standards.
**
1.3 Assumptions
The Eurocodes assume that data collection, design, construction and maintenance will all be
carried out consistently with good practice. The codes do not state who carries responsibility
for each of these aspects but it should be noted that they are addressed to designers. Adequate
documentation of all these aspects is essential to good practice.
It is clearly impossible for designers to control construction and maintenance. However, besides
ensuring that design is undertaken ‘by appropriately qualified and experienced personnel’,
designers should demand that data collection is adequately carried out, which, in the geotechnical
context, includes ground investigation. Guidance on investigations is provided by BS EN 1997-2
and by Uff and Clayton (1986, 1991).
Designers should also take responsibility for adequate specification of construction and the
preparation and communication of manuals and other documents related to maintenance.
It is assumed that ‘adequate continuity and communication exist between the personnel involved
in data-collection, design and construction’. This can be challenging in situations in which
structural and geotechnical design are carried out by different individuals or different companies.
For example, clear communication of the actions to be applied to foundations is essential, requiring
that all the engineers involved in the design understand and comply with the Eurocode system.
**
(4) The Application Rules are examples of generally recognised rules, which follow the Principles and
satisfy their requirements.
The Principles in EC7 are, in general, statements of essential good practice, on which the
Application Rules expand.
**
1.5 Definitions
1.5.2.1
geotechnical action
action transmitted to the structure by the ground, fill, standing water or ground-water
The meaning of the term ‘action’ in the context of geotechnical design has been much debated.
See comments in 2.4.2 for further information.
**
1.5.2.2
comparable experience
documented or other clearly established information related to the ground being considered in design,
involving the same types of soil and rock and for which similar geotechnical behaviour is expected, and
involving similar structures. Information gained locally is considered to be particularly relevant
Geotechnical design depends critically on the proper use of accumulated experience. However, this
can become an impenetrable and irrational black box, sometimes termed ‘engineering judgement’.
EC7 attempts to define ‘comparable experience’ so as to distinguish experience that is of genuine
relevance and also recorded in an objective fashion, so that it can be scrutinised and applied in an
appropriate manner.
1.5.2.3
ground
soil, rock and fill in place prior to the execution of the construction works;
1.5.2.4
structure
organised combination of connected parts, including fill placed during execution of the construction
works, designed to carry loads and provide adequate rigidity
Generally, the term ‘structure’ has to be understood in its context. This definition shows that it may
include structural fill as, for example, in an embankment.
**
1.5.2.5
derived value
value of a geotechnical parameter obtained by theory, correlation or empiricism from test results
1.5.2.6
stiffness
material resistance against deformation
1.5.2.7
resistance
The term ‘resistance’ is used to denote the capacity of a component or cross-section, such as bending
resistance, buckling resistance, bearing resistance (or bearing capacity), pile resistance/capacity or
passive resistance. It should be seen as distinct from the strength of material. Partial factors are
applied either to the strength of material or to ‘resistance’, depending on the approach adopted.
**
1.6 Symbols
In this text, symbols and abbreviations will be defined in context as they are needed. For the full
list, see BS EN 1997-1.
**
The essence of limit state design is to set up ‘design situations’ which, in some cases, might be
quite severe, and then to show that relevant limit states would not be exceeded if those situations
were to exist.
(2) When defining the design situations and the limit states, the following factors should be
considered:
This is one of many checklists provided in EC7. Although the items listed may sometimes seem
obvious, they represent issues that have repeatedly caused failures when they have been overlooked
in construction projects. A quick check against these lists is therefore strongly recommended.
To facilitate this, selected lists have been formatted as pro formas in Appendix 2. Users are
encouraged to add their own items to these lists and blank lines are included for this purpose. If
significant omissions are noted, readers are asked to propose them to BSI for incorporation in a
future revision.
(3) Limit states can occur either in the ground or in the structure or by combined failure in the structure
and the ground.
(5) In practice, experience will often show which type of limit state will govern the design and the
avoidance of other limit states may be verified by a control check.
(6) Buildings should normally be protected against the penetration of ground-water or the transmission
of vapour or gases to their interiors.
(7) If practicable, the design results should be checked against comparable experience.
(8) to (21) –these paragraphs introduce the concept of ‘Geotechnical Categories’. The intention of
these is to identify the degree of complexity of each design, varying from simple and conventional
to unusual and difficult, so that suitably experienced and qualified engineers can be assigned to it
and appropriate procedures can be used in design. It is important to assess complete designs, as
well as each of their components in this way. The system of classification has not been used much
in BS EN 1997-1 but it is used slightly more in BS EN 1997-2, in order to propose the amount of
ground investigation and types of test to be undertaken.
**
Paragraph (2) constitutes a checklist of items relevant to design situations, which is provided in a
ready-to-use form in Appendix 2.
**
2.3 Durability
(1)P At the geotechnical design stage, the significance of environmental conditions shall be assessed in
relation to durability and to enable provisions to be made for the protection or adequate resistance of
the materials.
Paragraph (2) constitutes a checklist of items relevant to durability, which is provided in a ready-to-
use form in Appendix 2.
**
2.4.1 General
(1)P Design by calculation shall be in accordance with the fundamental requirements of EN 1990:2002
and with the particular rules of this standard. Design by calculation involves:
— actions, which may be either imposed loads or imposed displacements, e.g. from ground
movements;
— properties of soils, rocks and other materials;
— geometrical data;
— limiting values of deformations, crack widths, vibrations, etc.;
— calculation models.
BS EN 1990 indicates that calculations will normally be carried out using partial factor methods.
This requires that parameters are first represented by ‘characteristic’ values and then factored to
obtain ‘design’ values that are entered into calculations. As the factors have already been applied,
no further overall ‘factor of safety’ is required. In principle, the process is the same for both
ultimate and serviceability limit states, though in practice all the partial factors γ are generally set
to 1.0 for serviceability calculations.
In this process, the partial factors may be applied to actions, action effects, material properties or
resistances (i.e. capacities), as detailed later.
(2) It should be considered that knowledge of the ground conditions depends on the extent and quality
of the geotechnical investigations. Such knowledge and the control of workmanship are usually more
significant to fulfilling the fundamental requirements than is precision in the calculation models and
partial factors.
(3)P The calculation model shall describe the assumed behaviour of the ground for the limit state under
consideration.
(4)P If no reliable calculation model is available for a specific limit state, analysis of another limit
state shall be carried out using factors to ensure that exceeding the specific limit state considered is
sufficiently improbable. Alternatively, design by prescriptive measures, experimental models and load
tests, or the observational method, shall be performed.
Paragraph (4) is mainly relevant to calculations for serviceability limit states. Displacements
are often very difficult to calculate, so it is common practice to use a calculation for a plastic
mechanism with a factor of safety applied to ensure that displacement will be ‘small enough’.
These ideas are developed in 2.4.8(4) and used in 6.6.2(16), for settlement of spread foundations
on clays. Bolton has proposed that this approach can be put onto a rational framework for both
foundations and retaining structures, and this thinking influenced the drafting of BS 8002 in 1994
(Bolton et al, 1990a, 1990b; Osman et al, 2004, 2006).
— an analytical model;
— a semi-empirical model;
— a numerical model.
(6)P Any calculation model shall be either accurate or err on the side of safety.
It is an underlying assumption of EC7 that any error in calculation methods is on the conservative
side. The partial factor values provided are not intended to allow for any optimism in the
calculation method. (See ‘Safety format in EC7 calculations’ in the Preface to this book for a
discussion of the purposes of the factors.)
Paragraphs (8) and (9) note that where the calculation method is by nature optimistic (such as
an upper bound method), it may be adjusted to become conservative by application of a ‘model
factor’, used together with the other partial factors required by EC7. The calculation methods
specifically recommended in EC7 do not fall into this category. In other situations in which the only
calculation available is potentially optimistic, the value of model factor required should be judged
by the designer; in some cases, reference to previous practice could inform this design.
The UKNA requires the use of model factors in pile design, since calculation of pile resistance from
the results of ground tests is considered to be an uncertain process. As a further example, Figure X12
shows a raft foundation to be designed to accept a heavy load. The ground surface is irregular and
soil strata, with markedly different properties, lie within a potential slip surface for bearing capacity.
Since a simple calculation was not readily available, the designer wanted to use a method of slices
slip circle calculation. However, comparisons with uniform material showed that this could be
unconservative, so a model factor was introduced to prevent this inaccuracy having an unsafe effect.
(8) If needed, a modification of the results from the model may be used to ensure that the design
calculation is either accurate or errs on the side of safety.
(9) If the modification of the results makes use of a model factor, it should take account of the
following:
(10)P If an empirical relationship is used in the analysis, it shall be clearly established that it is relevant
for the prevailing ground conditions.
As an example, one of the most commonly used empirical relationships in UK practice is the
adhesion factor, α, used in pile design. It is important to be able to demonstrate that the value
adopted has been calibrated in ‘the prevailing ground conditions’.
(11) Limit states involving the formation of a mechanism in the ground should be readily checked using
a calculation model. For limit states defined by deformation considerations, the deformations should
be evaluated by calculation as described in 2.4.8, or otherwise assessed.
Limit states such as a bearing capacity failure or ultimate pile failure involve ‘the formation of a
mechanism in the ground’ and these are usually ultimate limit states. Calculations can usually allow
development of some plasticity but see the following note and paragraph (13) on the subject of
ductility and brittleness.
Serviceability limit states such as excess settlement are ideally checked by making an estimate
of the settlement, either by calculation or by other means, such as recorded observations. For
example, observations of settlements related to embedded retaining walls are provided by CIRIA
Report 580 (Gaba et al, 2003). Calculations often assume linear behaviour up to SLS but this is not
a requirement of EC7 and may sometimes be an unnecessary restriction.
NOTE Many calculation models are based on the assumption of a sufficiently ductile performance of the ground/
structure system. A lack of ductility, however, will lead to an ultimate limit state characterised by sudden collapse.
Ductility is of great value and should be a feature of good design as far as possible. Where it is
impractical to have ductile structures or where the ground, by nature, is brittle, extra caution
should be employed. This point is taken up again in paragraph (13) in the context of using
numerical analysis.
(12) Numerical methods can be appropriate if compatibility of strains or the interaction between the
structure and the soil at a limit state are considered.
(13) Compatibility of strains at a limit state should be considered. Detailed analysis, allowing for
the relative stiffness of structure and ground, may be needed in cases where a combined failure of
structural members and the ground could occur. Examples include raft foundations, laterally loaded
piles and flexible retaining walls. Particular attention should be paid to strain compatibility for materials
that are brittle or that have strain-softening properties.
In non-ductile situations, results of analysis may depend critically on relative stiffnesses of structural
elements and the ground, which are difficult to prescribe accurately. Ductile structures can be
analysed more reliably, especially for ULS.
(14) In some problems, such as excavations supported by anchored or strutted flexible walls, the
magnitude and distribution of earth pressures, internal structural forces and bending moments depend
to a great extent on the stiffness of the structure, the stiffness and strength of the ground and the
state of stress in the ground.
(15) In these problems of ground-structure interaction, analyses should use stress-strain relationships
for ground and structural materials and stress states in the ground that are sufficiently representative,
for the limit state considered, to give a safe result.
2.4.2 Actions
(1)P The definition of actions shall be taken from EN 1990:2002. The values of actions shall be taken
from EN 1991, where relevant.
‘Actions’ is the term used in Eurocodes for loads. They can be represented as forces, pressures,
stresses or imposed displacements or strains. In the author’s understanding, actions were originally
defined such that their values were known at the start of the calculation and so factors could be
applied to them. However, this definition has been eroded and factors are now placed on both
known quantities and those derived during calculation. Opinions are divided as to the benefits of
this more flexible approach.
As in his third law, Newton would have called the known values ‘actions’ and the derived values
‘reactions’. In Eurocodes, ‘reactions’ are generally called ‘action effects’.
In geotechnical calculations, the forces that pass between the structure and the ground are variously
termed either ‘actions’ or ‘action effects’, and the differing ‘Design Approaches’ (see 2.4.7.3.4)
specify whether factors are to be applied to them. Most importantly, paragraph (3) notes that
ground-structure interaction should be considered in determining the values of such forces.
Paragraph (4) provides a checklist of actions that might have to be considered in geotechnical
design. This is provided in a ready-to-use form in Appendix 2.
Paragraphs (5) to (9) warn that particularly careful consideration should be given to: variable
actions in combination; actions that are time-dependent, applied repeatedly or rapidly enough to
create a dynamic response; and actions due to water pressure.
An important note is added to paragraph (9) about the ‘single source principle’. For further
discussion of this, see the comments on 2.4.7.2.
**
NOTE Unfavourable (or destabilising) and favourable (or stabilising) permanent actions may in some situations
be considered as coming from a single source. If they are considered so, a single partial factor may be applied to
the sum of these actions or to the sum of their effects.
EC7 anticipates that ground properties will be assessed by competent personnel, aiming to obtain
values that represent the actual situation in the ground, which might be different from the values
obtained directly in tests. This is discussed further below under 2.4.5.2. As various limit states
are considered, such as settlements or gross failures, the values of ground properties selected for
calculations should be relevant to the prevention of those particular limit states being exceeded.
Paragraph (4) constitutes a checklist of items that might cause differences between actual ground
properties and test results. This is provided in a ready-to-use form in Appendix 2.
Paragraph (5) makes it clear that no legitimate source of information about ground parameters
should be disregarded. Evaluation of parameters should not be restricted to sampling and testing
at the construction site but should take account of all relevant information. This is developed
further in 2.4.5.2.
**
(5) When establishing values of geotechnical parameters, the following should be considered:
— published and well recognised information relevant to the use of each type of test in the
appropriate ground conditions;
— the value of each geotechnical parameter compared with relevant published data and local and
general experience;
— the variation of the geotechnical parameters that are relevant to the design;
— the results of any large scale field trials and measurements from neighbouring constructions;
— any correlations between the results from more than one type of test;
— any significant deterioration in ground material properties that may occur during the lifetime of
the structure.
**
Characteristic values are the initial ‘unfactored’, though generally cautious, values by which
parameters are represented.
EC7 does not discuss issues related to load combinations but refers the reader to BS EN 1990.
This shows how combination factors ψ are applied to characteristic values of actions to obtain
‘representative values’, as noted below at equation (2.1b).
The selection of characteristic values for geotechnical parameters is critical to design and has been
much debated. The problem is not new: representation of ground properties by numerical values for
calculation has always been difficult and potentially contentious. The intention of the code drafters
here was to define a value that could be used in a manner compatible with characteristic values in
structural design, while being suited to the geotechnical context. The derivation of the value is not a
simple statistical process and depends heavily on the knowledge and expertise of the designer.
• Assessment of characteristic values should use available information, including test results,
published data, results of field tests and monitoring exercises.
• The characteristic value is to be a ‘cautious estimate’ [paragraph (2)] of the value actually
available in the ground to prevent the occurrence of a limit state. This will generally be more
pessimistic than the ‘most probable’ value, the difference between the two depending on the
level of uncertainty. Caution will usually require strengths lower than the most probable but, for
some limit states, higher strengths may be more adverse for some of the parameters.
• The characteristic value has to be relevant to the limit state being considered, noting the extent
of the ground involved. This means that a single soil stratum might have different characteristic
values for different limit states or failure modes [see further under paragraph (7) below].
• All available information should be properly considered. Where there are other sources of
relevant information, such as from previous experience or publications, the characteristic value is
not based on test results alone [paragraph (4)].
• In some cases it might be helpful to use statistical methods, at least to give an initial suggestion
of the characteristic value. For these, it is proposed [paragraph (11)] that the probability of a
worse value occurring in such a way as to allow a limit state to occur should be not greater
than 5%. Simpson et al (2009) summarise publications showing how this can be related to the
standard deviation of the data. They also compare the use of a ‘conservatively assessed mean’
proposed by American authorities, which typically is defined to require a 75% exceedance by the
test results. These approaches are only suitable when there are sufficient data points available
and they require significant understanding of statistical methods on the part of the designer. It
should be re-emphasised that the data used in this way are assumed to be representative of the
real behaviour in the ground, which may require considerable processing of directly measured
test results.
In relation to angle of shearing resistance, the question has been asked: ‘Which value is the
characteristic value?’ It is sometimes necessary to choose from one of the following, depending on
circumstances:
In all cases, the answer of Eurocode 7 is: ‘The one that is relevant to the prevention of the limit
state under consideration.’ EC7 does not differ in this respect from conventional practice. For some
particular situations, the code is able to specify which of these values is relevant. For example,
where concrete is to be cast against ground, which might therefore be disturbed, the critical state
(or constant volume) value for the angle of shearing resistance, ϕ'cv , is required (EC7, 6.5.3(10),
9.5.1(6)). In considering rocks, a study of the joint patterns will determine whether intact or joint
strength is relevant (EC7, 3.3.8).
This answer to the question is not the same as: ‘The one which would become relevant if the limit
state was not prevented.’ For example, in most plastic clays, if a slip occurred, the angle of shearing
resistance would eventually fall to the residual value. Nevertheless, it is not necessary to design
for residual strength in clays which have not previously slipped. Similarly, it may be unnecessary
to design for critical state values, though brittleness and ductility should be considered, as noted
in 2.4.1(11, 13).
Generally the strength to be used in Eurocode 7 is the maximum available to prevent collapse, not
a mobilised value.
(1)P The selection of characteristic values for geotechnical parameters shall be based on results and
derived values from laboratory and field tests, complemented by well-established experience.
(2)P The characteristic value of a geotechnical parameter shall be selected as a cautious estimate of the
value affecting the occurrence of the limit state.
(3)P The greater variance of c' compared to that of tanϕ ' shall be considered when their characteristic
values are determined.
(4)P The selection of characteristic values for geotechnical parameters shall take account of the
following:
— geological and other background information, such as data from previous projects;
— the variability of the measured property values and other relevant information, e.g. from existing
knowledge;
— the extent of the field and laboratory investigation;
— the type and number of samples;
— the extent of the zone of ground governing the behaviour of the geotechnical structure at the limit
state being considered;
— the ability of the geotechnical structure to transfer loads from weak to strong zones in the ground.
(5) Characteristic values can be lower values, which are less than the most probable values, or upper
values, which are greater.
(6)P For each calculation, the most unfavourable combination of lower and upper values of
independent parameters shall be used.
(7) The zone of ground governing the behaviour of a geotechnical structure at a limit state is usually
much larger than a test sample or the zone of ground affected in an in situ test. Consequently the
value of the governing parameter is often the mean of a range of values covering a large surface or
volume of the ground. The characteristic value should be a cautious estimate of this mean value.
As an example, Figure X13 shows a proposed building near the top of a slope. A single stratum is
involved, consisting of sand with some occasional lenses of clay, considered to be weaker than the
sand. The characteristic strength (or angle of shearing resistance) of the soil deposit is to be assessed
for two ULS conditions: overall slope failure and local bearing failure of a footing. The overall failure
will pass through a large amount of soil, so it is reasonable to take an average of the strengths of
the sand and clay for this calculation (though it would be necessary to consider whether a failure
mechanism could occur predominantly in the weaker material). For each footing, however, it is
necessary to consider that it could be underlain by a clay lens, which would dominate the bearing
resistance available to it. Thus a lower characteristic value for the soil should be taken for the
footing than for the slope stability, despite the fact that both are in the same variable stratum.
(There is a further possible alternative: probing could be carried out beneath each footing and any
clay removed, ensuring good material for which a higher characteristic value could be used.)
(8) If the behaviour of the geotechnical structure at the limit state considered is governed by the lowest
or highest value of the ground property, the characteristic value should be a cautious estimate of the
lowest or highest value occurring in the zone governing the behaviour.
(9) When selecting the zone of ground governing the behaviour of a geotechnical structure at a limit
state, it should be considered that this limit state may depend on the behaviour of the supported
structure. For instance, when considering a bearing resistance ultimate limit state for a building resting
on several footings, the governing parameter should be the mean strength over each individual zone
of ground under a footing, if the building is unable to resist a local failure. If, however, the building is
stiff and strong enough, the governing parameter should be the mean of these mean values over the
entire zone or part of the zone of ground under the building.
(10) If statistical methods are employed in the selection of characteristic values for ground properties,
such methods should differentiate between local and regional sampling and should allow the use of a
priori knowledge of comparable ground properties.
(11) If statistical methods are used, the characteristic value should be derived such that the calculated
probability of a worse value governing the occurrence of the limit state under consideration is not
greater than 5%.
NOTE In this respect, a cautious estimate of the mean value is a selection of the mean value of the limited set
of geotechnical parameter values, with a confidence level of 95%; where local failure is concerned, a cautious
estimate of the low value is a 5% fractile.
(12)P When using standard tables of characteristic values related to soil investigation parameters, the
characteristic value shall be selected as a very cautious value.
(2) Characteristic values of levels of ground and dimensions of geotechnical structures or elements
should usually be nominal values.
Design values are the values actually entered into calculations. They are derived from the
characteristic values (or, in the case of actions, from ‘representative values’) by applying partial
factors γ . Thus ‘design values’ are factored values. This usage should not be confused with
traditional UK usage in which ‘design values’ usually were more akin to the ‘characteristic values’
of the Eurocodes.
Design values are required for both ultimate and serviceability limit states. However, for SLS the
factor γ is usually 1.0, making the design value numerically equal to the characteristic value or
representative action.
‘Direct assessment’ of design values is also permitted. If this is done, the level of safety required
should be respected and the code says that the values of the partial factors recommended in
Annex A should be used as a guide to the required level of safety. The author recommends that,
if direct assessment is used, the designer should be very confident that a worse value could not
occur in practice. In fact, the design value should be even more severe than this, incorporating a
margin to accommodate typical unplanned occurrences, i.e. it must have a degree of ‘robustness’
(Simpson et al, 2011). This issue is noted further below under 2.4.6.1(2) and 2.4.6.2(1).
Particular care should be given to the concept of ‘favourable’ and ‘unfavourable’ actions,
both permanent and variable. This classification may not be the same for both structural and
geotechnical design. In particular, soil gains its strength mainly through friction, so an increase
in direct stress may lead to an increase in strength and so would be ‘favourable’. In some cases,
it will not be obvious whether a particular action is favourable or unfavourable to the limit
state considered, and it will then be necessary to consider both possibilities in forming load
combinations for design.
(2)P The design value of an action (Fd) shall either be assessed directly or shall be derived from
representative values using the following equation:
Fd = γ F · Frep (2.1a)
with
Frep = ψ · Fk (2.1b)
For use of the ψ factor, see the note under 2.4.5.1(1), above.
For construction in the UK, values of γ F and ψ are given in the UK National Annex to
BS EN 1990:2002. For simple situations, values of γ F for buildings are provided in Annex A of
this book.
An alternative to the use of partial factors is allowed here. The designer may choose to select
design values ‘directly’ without the process of multiplying representative values by partial factors γ .
This approach is discussed above under 2.4.6. Paragraph (5) cautions that the level of safety
required should be respected. Paragraph (6) invites use of this approach for water pressures.
Attention is drawn to the discussion of the purpose of partial factors in the Preface to this book.
**
(6)P When dealing with ground-water pressures for limit states with severe consequences (generally
ultimate limit states), design values shall represent the most unfavourable values that could occur
during the design lifetime of the structure. For limit states with less severe consequences (generally
serviceability limit states), design values shall be the most unfavourable values which could occur in
normal circumstances.
For ultimate limit states, the designer is asked to imagine the worst water pressures that are credible.
For serviceability limit states, the requirement is the worst that is reasonably likely. These water
pressures are then to be taken as ‘design’ values, meaning that no further factors are applied to them.
Paragraph (7) notes that some imaginable water pressures may be so unlikely that they could be
treated as ‘accidental’ values. This implies that they are used in combination with less severe values
of other variables, as noted in BS EN 1990:2002 (e.g. 6.4.3.3) and in 2.4.7.1 below.
Paragraph (8) states that design values of water pressures could be derived by factoring
characteristic values. However, the UKNA advises against this (A2.1 and A3.1), preferring the use
of paragraphs (2) and (6) or the use of a safety margin on water level as in paragraph (8). In effect,
this approach treats the water level as a geometric parameter, consistently with 2.4.6.3(2) below.
Similarly, PD 6694-1 states: ‘because of the site-specific nature of uncertainty in water levels and the
associated difficulties in calibration, no partial factor is given for ground-water pressure in the UK
National Annex to BS EN 1990 for the design of bridges.’
(7) In some cases extreme water pressures complying with 1.5.3.5 of EN 1990:2002, may be treated as
accidental actions.
(8) Design values of ground-water pressures may be derived either by applying partial factors to
characteristic water pressures or by applying a safety margin to the characteristic water level in
accordance with 2.4.4(1)P and 2.4.5.3(1)P.
(9) The following features, which may affect the water pressures should be considered:
(10) Consideration should be given to unfavourable water levels that may be caused by changes in the
water catchment and reduced drainage due to blockage, freezing or other causes.
(11) Unless the adequacy of the drainage system can be demonstrated and its maintenance ensured,
the design ground-water table should be taken as the maximum possible level, which may be the
ground surface.
Xd = X k / γ M (2.2)
As for actions in 2.4.6.1, an alternative to the use of partial factors is allowed here. The designer
may choose to select design values ‘directly’ without the process of multiplying characteristic
values by partial factors γ . This approach is discussed above under 2.4.6. Paragraph (3) cautions
that the level of safety required should be respected.
For construction in the UK, values of γ M are given in the UK National Annex to BS EN 1997-1:2004,
Annex A (see pages 114–127).
**
(3) If design values of geotechnical parameters are assessed directly, the values of the partial factors
recommended in Annex A should be used as a guide to the required level of safety.
(2)P In cases where deviations in the geometrical data have a significant effect on the reliability of a
structure, design values of geometrical data (ad) shall either be assessed directly or be derived from
nominal values using the following equation (see 6.3.4 of EN 1990:2002):
ad = anom ± Δa (2.3)
This sub-clause is taken up in relation to water pressure (2.4.6.1(8)), highly eccentric loading on
spread foundations (6.5.4(2)) and the level of soil providing passive restraint to retaining walls
(9.3.2.2).
2.4.7.1 General
(1)P Where relevant, it shall be verified that the following limit states are not exceeded:
— loss of equilibrium of the structure or the ground, considered as a rigid body, in which the strengths
of structural materials and the ground are insignificant in providing resistance (EQU);
— internal failure or excessive deformation of the structure or structural elements, including e.g.
footings, piles or basement walls, in which the strength of structural materials is significant in
providing resistance (STR);
— failure or excessive deformation of the ground, in which the strength of soil or rock is significant in
providing resistance (GEO);
— loss of equilibrium of the structure or the ground due to uplift by water pressure (buoyancy) or
other vertical actions (UPL);
— hydraulic heave, internal erosion and piping in the ground caused by hydraulic gradients (HYD).
NOTE Limit state GEO is often critical to the sizing of structural elements involved in foundations or retaining
structures and sometimes to the strength of structural elements.
In geotechnical design, it is often the case that a structure and the ground can only fail when both
fail together, so limit states STR and GEO merge. In practice, the same factors are quoted for both.
Figures that clarify the definition of UPL and HYD are presented in Section 10, which is not
included in this book.
Values of partial factors γ for construction in the UK are provided in Annex A of this book.
Paragraphs (4) and (5) indicate that more, or less, severe values should be considered in exceptional
circumstances. This issue is discussed in Annex B of BS EN 1990:2002, where the possibility of
increasing or reducing factors on actions by 10% is suggested. Alternatives also noted are more
thorough checking of design (e.g. third-party checking) and varying levels of supervision of design
and inspection of construction. The UKNA adds no specific instruction but says that the values
should be agreed with the client and relevant authorities.
A particular issue is the value of factors to be used in design for temporary situations, including
‘temporary works’. Paragraph (5) states that factors can only be reduced ‘where the likely
consequences justify it’. In some cases, during site works the consequences of a failure may be
less than in the finished project or an incipient failure may be preventable by the vigilance of site
workers. In such situations, a reduction in values of partial factors may be acceptable but this is
not on the basis of the temporary nature of the situation alone. This was discussed at length by
Magnus et al (2005), as noted by Simpson et al (2008).
For accidental situations, the UKNA (Table NA.1) requires that the partial factor on all actions or the
effects of actions is 1.0. The table is not fully clear what values are to be taken for resistances (and,
by implication, material strengths) but the author understands it to mean that the values are to be
the same as for STR and GEO.
**
Limit state EQU was devised to ensure safety in situations where equilibrium depends on a delicate
balance of permanent loads. It is particularly relevant if the dominant permanent action comes
from a ‘single source’, but could be divided into different parts. In such cases, the single permanent
action has to be divided into parts to which differing partial factors are applied.
An example is shown in Figure X10. The balanced beam is a ‘single source’ represented as two
equal forces: W. Ideally, this causes no bending moment in the column and equal compressive
forces in the two piles. However, if some small variation in the load from the beam were to occur,
it could cause significant bending moments in the column and variations of force in the piles,
possibly putting one of them into tension.
In some cases, calculations that use the partial factors of EQU will lead the designer to ensure
equilibrium by using the strength of some structural or ground material. For example, in
Figure X10, EQU could create a demand, not otherwise needed, for bending strength in the
column or for additional compressive or tensile resistance in the piles. Design for such situations is
still under discussion among the developers of the Eurocodes.
EQU is called by BS EN 1990 a ‘limit state’. However, in the view of the author it is better to
understand EQU simply as an additional set of load factors. In principle, all designs must be able
to accommodate the EQU load factors, though in practice it will be obvious by inspection in most
cases that they are not critical.
Some geotechnical examples of EQU are discussed by Schuppener et al (2009) and by Simpson
et al (2009). The values of partial factors for EQU in the UKNA (A.2 in the UKNA Annex A on
pages 114–116 of this book) have been chosen with the aim of preventing EQU appearing to be
critical when it was not intended to be so.
(1)P When considering a limit state of static equilibrium or of overall displacements of the structure or
ground (EQU), it shall be verified that:
with
and
**
2.4.7.3 Verification of resistance for structural and ground limit states in persistent
and transient situations
2.4.7.3.1 General
(1)P When considering a limit state of rupture or excessive deformation of a structural element or
section of the ground (STR and GEO), it shall be verified that:
Ed ≤ Rd (2.5)
Equation 2.5 is the basic check required for most design calculations. It simply states that at critical
points in the ground/structural system, it shall be checked that the available design (i.e. factored)
resistance is greater than the design effect of all the loading (including partial load factors). No
further factor of safety is required.
‘Rd’ could represent design resistances such as the bearing capacity of a spread foundation, the
capacity of a pile or pile group or the bending resistance of a retaining wall. Ed would then be the
design value of the combined action effects exploiting that particular resistance.
Requirement 2.5 has to hold at all points in the ground/structural system – the available strength
can never be exceeded.
When all possible partial factors are incorporated, equation 2.5 could be expanded as:
where E{ } indicates a calculation deriving action effects from actions (e.g. a load take-down) and
R{ } shows a calculation deriving resistance from material strengths.
Requirement 2.5* is never used in this form and simplified versions are presented with fewer γ
factors. This form of the requirement shows a factor γ F applied to the actions F together with γ E
applied to the derived action effect, E. Both of these are allowed by EC7 but, in practice, only one
of these factors is applied. Similarly, when determining Rd, only one of γ M and γ R is used.
However, a notable feature of equation 2.5* is important to geotechnical design: mainly because
soil is a frictional material, resistance is sometimes a function of actions and action effects
are sometimes a function of material strengths. Examples include sliding resistance, which is
dependent on the loads acting normally to the sliding surface, and earth pressures, which are
dependent on soil strength.
The values of factors to be used in these equations are given in Annex A of this book (A.3).
(2) In some design situations, the application of partial factors to actions coming from or through the
soil (such as earth or water pressures) could lead to design values, which are unreasonable or even
physically impossible. In these situations, the factors may be applied directly to the effects of actions
derived from representative values of the actions.
In geotechnical calculations, confusion often arises if load factors are applied to the weight, or
density, of the ground or ground-water. Paragraph (2) provides a way of avoiding this by factoring
the resulting action effects. This is important in the design of retaining structures, for example,
where this paragraph makes it permissible to factor resulting bending moments, shear forces and
strut forces after they have been calculated, for example, rather than pre-factoring the density of
the ground before the calculation. It is the author’s recommendation that this approach be used
with Design Approach 1, Combination 1. In Combination 2, permanent actions have a load factor
of 1.0, so the issue does not arise.
**
2.4.7.3.4.1 General
The way in which requirement 2.5* is applied is governed by the choice of one of three available
‘Design Approaches’ (DA1, DA2, DA3). The UKNA specifies that DA1 shall be used for construction
in the UK. The main reasons for this choice are discussed by Simpson (2007). Simpson et al (2009)
summarise them as follows.
• It facilitates consistent analysis of combined problems, which are very common, involving,
for example, a slope, loaded by a structure, supported by a retaining wall, itself supported by
anchors and foundations.
• Because the strength of soil is derived from friction, non-linear or disproportionate relationships
between soil parameters and resistances are common. In these circumstances, it is important
to check designs with partial factors applied to the basic strength parameters of the soil, as
explained fully in BS EN 1990 (6.3.2). Such non-linear relationships occur, for example in the
derivation of bearing capacity factors (e.g. Nγ ) or of coefficient of passive resistance (Kp) from
angle of shearing resistance, as illustrated in Figure X14. (Kp is plotted for δ/φ=2⁄3.)
• It can be used readily with both simple hand calculations and more complex finite element
calculations. Introduction of resistance factors into finite element computations, which
essentially require overall equilibrium, has proved to be difficult. Demonstration of equilibrium of
complete systems is fundamental to good design practice.
**
DA1 requires that, for ULS, designs are checked, in principle, by two separate calculations involving
different values for partial factors γ . In ‘Combination 1’ (C1), actions are factored, much as for
structural design, and the strength of the ground is not factored. In ‘Combination 2’ (C2), the
strength of the ground is factored and the factor on actions is 1.0, except that a small value
(γ Q = 1.3) is applied to unfavourable variable actions, and favourable variable actions are omitted –
i.e. γ Q = 0. For piles and anchors, the material (or resistance) factor is effectively applied to the soil
at the interface between the structure and the ground and, for this, special values are provided.
If it is obvious that one of the two combinations governs the design, calculations for the other
combination need not be carried out. In many cases, a little experience will soon show which one
is likely to be critical.
Annexes A of EC7, the UKNA and this book refer to sets of partial factors to be used in various
combinations: A1, A2, etc. for actions, M1, M2 for materials and R1, R4 for resistances. (Sets R2
and R3 are not used in DA1.) The ‘A’ factors are sometimes applied directly to actions (as γ F in
requirement 2.5*) and sometimes to action effects (as γ E). The values of the factors required for
design of buildings by the UKNA are summarised in Figure X1.
In general, the factors on actions in C1 are the same as used in structural design, ensuring that
foundations can always accept the ULS design loads from supported structures, albeit with no
further factor of safety in the ground. In most cases, the check on the strength of the ground is
more critical in C2 than in C1. Forces or stress distributions are derived from the ground in retaining
structures and as reactions in foundations. These are obtained from both C1 and C2 and should be
treated as ULS design values for checking structures, implying that no further load factor is to be
applied to them. The more critical design loading for structures may come from either C1 or C2.
Because DA1 is the UK choice, the full text of 2.4.7.3.4.2 is retained here.
(1)P Except for the design of axially loaded piles and anchors, it shall be verified that a limit state of
rupture or excessive deformation will not occur with either of the following combinations of sets of
partial factors:
(2)P For the design of axially loaded piles and anchors, it shall be verified that a limit state of rupture
or excessive deformation will not occur with either of the following combinations of sets of partial
factors:
NOTE 2 In Combination 2, set M1 is used for calculating resistances of piles or anchors and set M2 for
calculating unfavourable actions on piles owing e.g. to negative skin friction or transverse loading.
(3) If it is obvious that one of the two combinations governs the design, calculations for the other
combination need not be carried out. However, different combinations may be critical to different
aspects of the same design.
DA2 requires a single calculation, in which factors are applied to actions and to resistances, such as
bearing capacity and passive resistance. It has been found that it is difficult to apply this approach
to slope stability problems and for finite element analysis, so most of the countries that have
adopted DA2 use DA3 for these.
**
In DA3, factors are applied to both actions and material strengths in the same calculation. This was
avoided in the UKNA because, if the factors are sufficient to cover all situations, it tends to be too
conservative in many cases.
**
where
Like EQU, UPL is about the balance of forces, generally with little involvement of material strength
but, in this case, one of the main forces comes from water pressure. Figure 10.1 of EC7 clarifies
the definition of the limit state. Although not explicitly stated, it is understood that the partial
factors are to be applied to representative actions or action effects. That is:
In the UKNA (Table A.NA.15), γ G;dst = 1.1, γ Q;dst = 1.5 and γ G;stb = 0.9. The UKNA requires that
any resistance involved, Rd, is calculated using the same factors as for STR/GEO (Table A.NA.16 –
see Figure X1). This is contrary to paragraph (2), below, which gives an alternative approach that is
not recommended.
(2) Additional resistance to uplift may also be treated as a stabilising permanent vertical action (Gstb;d).
**
Limit state HYD refers to hydraulic uplift. Figure 10.2 of EC7 clarifies the definition of the limit state.
(1)P When considering a limit state of failure due to heave by seepage of water in the ground (HYD,
see 10.3), it shall be verified, for every relevant soil column, that the design value of the destabilising
total pore water pressure (udst;d ) at the bottom of the column, or the design value of the seepage
force (Sdst;d) in the column is less than or equal to the stabilising total vertical stress (σ stb;d) at the
bottom of the column, or the submerged weight (G´stb;d) of the same column:
With consistent design values, these two formulations are physically equivalent, but Orr (2005)
demonstrated that very different design results could result, depending on how factors are
applied. Partial factor values are provided: the UKNA (A.5) gives γ G;dst = 1.35 and γ G;stb = 0.9.
Unfortunately, the code is not explicit about where the factors are to be applied and this has led to
much debate. Should factors be applied to water pressures, effective (or buoyant) weights, total
stresses, total weights, seepage forces ... ?
Unreasonable results tend to emerge if factors are applied to the density of water. The following
approach is recommended.
a) Design ground-water pressures, piezometric levels or seepage forces are better assessed
directly, rather than by applying partial factors [see comments on 2.4.6.1(6)].
b) If fixed safety elements are proposed for these, additive margins are preferable to multiplying
factors [see comments on 2.4.6.1(8)].
c) Similar approaches could also be used for γ or γ ' (noting that additive margins produce the
same result when applied to either parameter) but this is not too important as the value
proposed is close to unity – 0.9.
d) If it is required to apply partial factors to γ or γ ', using γ may provide a more appropriate and
consistent margin of safety.
**
In the context of EC7, serviceability limit states relate either to ground displacement (settlement,
lateral displacement of retaining walls, etc.) or to serviceability damage in structures (cracking, etc.). In
terms of calculation, they are to be prevented either by a cautious calculation of likely displacements
[paragraph (1)] or by ensuring that a sufficiently low fraction of the ground strength is mobilised
[paragraph (4)].
Although not stated explicitly in the code, serviceability may also be justified by using ‘prescriptive
measures’ as defined in 2.5. The ‘indirect method’ noted in 6.4(5) is one example of this, related to
settlement of spread foundations.
(1)P Verification for serviceability limit states in the ground or in a structural section, element or
connection, shall either require that:
Ed ≤ Cd, (2.10)
(2) Values of partial factors for serviceability limit states should normally be taken equal to 1,0.
**
(3) Characteristic values should be changed appropriately if changes of ground properties e.g. by
ground-water lowering or desiccation, may occur during the life of the structure.
(4) It may be verified that a sufficiently low fraction of the ground strength is mobilised to keep
deformations within the required serviceability limits, provided this simplified approach is restricted to
design situations where:
— a value of the deformation is not required to check the serviceability limit state;
— established comparable experience exists with similar ground, structures and application method.
(5)P A limiting value for a particular deformation is the value at which a serviceability limit state, such
as unacceptable cracking or jamming of doors, is deemed to occur in the supported structure. This
limiting value shall be agreed during the design of the supported structure.
The UKNA does not provide limiting values for movements but refers the reader to Annex H of
EC7. In practice, limiting values are dependent on the type of supported structure and should be
agreed with building designers and owners. Guidance is given by CIRIA Report C580 section 2.5.4
(Gaba et al, 2003).
(2)P Any differential movements of foundations leading to deformation in the supported structure shall
be limited to ensure that they do not lead to a limit state in the supported structure.
(3)P The selection of design values for limiting movements and deformations shall take account of the
following:
— the confidence with which the acceptable value of the movement can be specified;
— the occurrence and rate of ground movements;
— the type of structure;
— the type of construction material;
— the type of foundation;
— the type of ground;
— the mode of deformation;
— the proposed use of the structure;
— the need to ensure that there are no problems with the services entering the structure.
The checklists of paragraphs (3) and (4) are provided in ready-to-use forms in Appendix 2.
(2) Design by prescriptive measures may be used where comparable experience, as defined in 1.5.2.2,
makes design calculations unnecessary. It may also be used to ensure durability against frost action and
chemical or biological attack, for which direct calculations are not generally appropriate.
The concept has been developed in practice by Wong et al (1999) for slopes and retaining walls in
Hong Kong.
Load testing of structural elements is particularly important for piles and ground anchors, so these
principles are expanded in sections 7 and 8. Full scale tests or smaller scale models are sometimes
used in the design of embankments.
(1)P When the results of load tests or tests on large or small scale models are used to justify a design,
or in order to complement one of the other alternatives mentioned in 2.1(4), the following features
shall be considered and allowed for:
— differences in the ground conditions between the test and the actual construction;
— time effects, especially if the duration of the test is much less than the duration of loading of the
actual construction;
— scale effects, especially if small models are used. The effects of stress levels shall be considered,
together with the effects of particle size.
(2) Tests may be carried out on a sample of the actual construction or on full scale or smaller scale models.
Reference is often made to the ‘observational method’ (OM) during geotechnical design and
construction; some recent texts call the process ‘Interactive design’. Too often, this involves
monitoring without any ability to react to the results, if adverse, or even without proper scrutiny
of them (e.g. Health and Safety Executive, 2000; Magnus et al, 2005; Simpson et al, 2008). The
method can be used to great advantage, especially in the common situation where there is a wide
range of uncertainty in design parameters but the possibility exists to amend the design during
construction if observations suggest this would be beneficial to improve either safety or economy
(Peck, 1969; Nicholson et al, 1999).
The clauses provided here give the essential framework for a successful application of the method,
particularly in situations where a design is implemented that is less cautious than it could have
been without the OM.
(1) When prediction of geotechnical behaviour is difficult, it can be appropriate to apply the approach
known as “the observational method”, in which the design is reviewed during construction.
(4)P The results of the monitoring shall be assessed at appropriate stages and the planned contingency
actions shall be put into operation if the limits of behaviour are exceeded.
(5)P Monitoring equipment shall either be replaced or extended if it fails to supply reliable data of
appropriate type or in sufficient quantity.
(1)P The assumptions, data, methods of calculation and results of the verification of safety and
serviceability shall be recorded in the Geotechnical Design Report.
(2) The level of detail of the Geotechnical Design Reports will vary greatly, depending on the type of
design. For simple designs, a single sheet may be sufficient.
Paragraph (3) constitutes a checklist of items to be included in the Geotechnical Design Report,
which is provided in a ready-to-use form in Appendix 2.
**
(4)P The Geotechnical Design Report shall include a plan of supervision and monitoring, as appropriate.
Items, which require checking during construction or, which require maintenance after construction
shall be clearly identified. When the required checks have been carried out during construction, they
shall be recorded in an addendum to the Report.
Paragraph (5) constitutes a checklist of items relevant to supervision and monitoring, which is
provided in a ready-to-use form in Appendix 2.
**
(6)P An extract from the Geotechnical Design Report, containing the supervision, monitoring and
maintenance requirements for the completed structure, shall be provided to the owner/client.
Section 3 contains basic requirements for good practice in the process of collecting data and deriving
values for parameters. The requirements it states are important but they are not particular to EC7.
They might be regarded as well known and obvious by most engineers with some geotechnical
training. Failure to satisfy these requirements would, of course, constitute non-conformance with
the Eurocode.
For ground investigation in the UK, BS 5930 was extensively revised and republished in 2009. This
provides a much more detailed treatment of the subject of Section 3.
**
3.4.1 Requirements
(1)P The results of a geotechnical investigation shall be compiled in a Ground Investigation Report,
which shall form a part of the Geotechnical Design Report described in 2.8.
(2)P Reference shall be made to EN 1997-2 for information on the use of laboratory and field tests for
geotechnical parameters.
— a presentation of all available geotechnical information including geological features and relevant
data;
— a geotechnical evaluation of the information, stating the assumptions made in the interpretation of
the test results.
This sub-clause constitutes checklists of items relevant to presentation of factual data, which are
provided in a ready-to-use form in Appendix 2.
**
This sub-clause constitutes checklists of items relevant to presentation of interpretative data, which
are provided in a ready-to-use form in Appendix 2.
**
Paragraph 4.1(2) requires that necessary supervision and monitoring are specified in the
Geotechnical Design Report (see 2.8), making this specification the responsibility of the designer.
In addition to supervision and monitoring, it is essential to have the facility, both contractual and
practical, to respond to adverse observations.
Overall, the emphasis is on doing what is appropriate in particular circumstances and keeping
good records. The term ‘as appropriate’ is frequently used. Reference is made to the Geotechnical
Categories but distinctions between the actions noted are fairly imprecise and not mandatory.
Because it is fairly brief but sets out important principles, Section 4 is retained here in full.
4.1 General
(1)P To ensure the safety and quality of a structure, the following shall be undertaken, as appropriate:
(2)P Supervision of the construction process, including workmanship, and any monitoring of the
performance of the structure during and after construction, shall be specified in the Geotechnical
Design Report.
(3) Supervision of the construction process, including workmanship, should involve the following,
as appropriate:
(4) Observations and measurements of the behaviour of the structure and its surroundings should be
made, as appropriate:
— during construction, to identify any need for remedial measures or alterations to the construction
sequence, for example;
— during and post construction, to evaluate the long-term performance.
(5)P Design decisions, which are influenced by the results of the supervision and monitoring shall be
clearly identified.
(6) The amount of construction supervision and the quantity of field and laboratory testing required to
control and monitor performance should be planned during the design stage.
(7)P In the case of unexpected events, the methods, extent and frequency of monitoring shall be
reviewed.
(8)P The level and quality of supervision and monitoring shall be at least equal to those assumed in the
design and shall be consistent with the values selected for the design parameters and partial factors.
NOTE Annex J gives a checklist for construction supervision and performance monitoring.
4.2 Supervision
(2) The plan should specify the type, quality and frequency of supervision, which should be
commensurate with:
(2) For Geotechnical Category 1, the supervision programme may be limited to inspection, simple
quality controls and a qualitative assessment of the performance of the structure.
(3) For Geotechnical Category 2, measurements of ground properties or the behaviour of structures
should often be required.
(4) For Geotechnical Category 3, additional measurements should be required during each significant
stage of construction.
(6) Records of temporary works should also be kept. Interruptions to the works, and their condition on
re-commencement, should be recorded.
(7)P The results of the inspection and control shall be made available to the designer before any
changes are decided.
(8) In general, the design documents and records of what was constructed should be stored for 10
years, unless agreed otherwise. More important documents should be stored for the lifetime of the
relevant structure.
(2) The assessment of the design should include a careful review of the most unfavourable conditions,
which occur during construction with regard to:
— ground conditions;
— ground-water conditions;
— actions on the structure;
— environmental impacts and changes including landslides and rockfalls.
(2) For Geotechnical Category 1, the descriptions of the soils and rocks should be checked by:
(3) For Geotechnical Category 2, the geotechnical properties of the soil or rock in or on which the
structure is founded or located should also be checked. Additional site investigation may be needed.
Representative samples should be recovered and tested to determine the index properties, strength
and deformability.
(4) For Geotechnical Category 3, additional requirements should include further investigations and
examination of details of the ground or fill conditions, which may have important consequences for
the design.
(5) Indirect evidence of the geotechnical properties of the ground (for example, from pile driving
records) should be recorded and used to assist in interpreting the ground conditions.
(6)P Deviations from the ground type and properties assumed in the design shall be reported without
delay.
NOTE Normally these deviations are reported to the designer.
(7)P The principles used in design shall be checked to ensure that they are appropriate for the
geotechnical features of the ground, which are encountered.
4.3.2 Ground-water
(1)P As appropriate, the ground-water levels, pore-water pressures and ground-water chemistry
encountered during execution shall be compared with those assumed in the design.
(2) More thorough checks should be performed for sites on which significant variations of ground type
and permeability are known or believed to exist.
(3) For Geotechnical Category 1, checks should usually be based on previously documented experience
in the area or on indirect evidence.
(4) For Geotechnical Categories 2 and 3, direct observations should normally be made of the ground-
water conditions if these greatly affect either the method of construction or the performance of the
structure.
(5) Ground-water flow characteristics and the pore-water pressure regime should be obtained by
means of piezometers, which preferably should be installed before the start of construction operations.
It may sometimes be necessary to install piezometers at large distances from the site as part of the
monitoring system.
(6) If pore-water pressure changes occur during construction that may affect the performance of the
structure, pore-water pressures should be monitored until construction is complete or until the pore-
water pressures have dissipated to safe values.
(7) For structures below ground-water level, which may be subject to uplift, pore-water pressures
should be monitored until the weight of the structure is sufficient to rule out the possibility of uplift.
(8) Chemical analysis of mobile water should be performed when any part of the permanent or
temporary works may be significantly affected by chemical attack.
(9)P The effect of construction operations (including processes such as dewatering, grouting and
tunnelling) on the ground-water regime shall be checked.
(10)P Deviations from the ground-water features assumed in the design shall be reported without
delay.
(11)P The principles used in design shall be checked to ensure that they are appropriate for the ground-
water features, which are encountered.
(2)P Deviations from the methods of construction assumed in the design and stated in the
Geotechnical Design Report shall be explicitly and rationally considered and implemented.
(3)P The principles followed in design shall be checked to ensure that they are appropriate for the
sequence of construction operations, which are used.
(4) For Geotechnical Category 1, a formal construction schedule need not normally be included in the
Geotechnical Design Report.
NOTE The sequence of construction operations is normally decided by the contractor.
(5) For Geotechnical Categories 2 and 3, the Geotechnical Design Report may give the sequence of
construction operations envisaged in the design.
NOTE Alternatively, the Geotechnical Design Report can state that the sequence of construction is to be decided
by the contractor.
4.5 Monitoring
Some readers have understood 4.5(1) to mean that all constructions conforming to EC7 have to be
monitored, presumably by measuring displacements and other parameters. However, the intention
of this paragraph is really only to note what monitoring should be expected to achieve, on those
occasions when it is appropriate to use it.
The text of EC7 concentrates on monitoring that involves measurement. However, it is emphasised
here that the vigilance and common sense observations of site staff may often be equally valuable,
especially in noticing the development of an adverse situation.
(2)P The monitoring programme shall be carried out in accordance with the Geotechnical Design
Report (see 2.8(3)).
(3) Records of the actual performance of structures should be made in order to collect databases of
comparable experience.
(5) Results of measurements should be integrated with qualitative observations including architectural
appearance.
(6) The length of any post-construction monitoring period should be altered as a result of observations
made during construction. For structures that may impact unfavourably on appreciable parts of the
surrounding physical environment, or for which failure may involve abnormal risks to property or life,
monitoring should be required for more than ten years after construction is complete, or throughout
the life of the structure.
(7)P The results obtained from monitoring shall always be evaluated and interpreted and this shall
normally be done in a quantitative manner.
(8) For Geotechnical Category 1, the evaluation of performance may be simple, qualitative and based
on inspection.
(9) For Geotechnical Category 2, the evaluation of performance may be based on measurements of
movements of selected points on the structure.
(10) For Geotechnical Category 3, the evaluation of performance should normally be based on the
measurement of displacements and analyses, which take account of the sequence of construction
operations.
(11)P For structures that may have an adverse effect on ground or ground-water conditions, the
possibility of leakage or of alterations to the pattern of ground-water flow, especially when fine
grained soils are involved, shall be taken into account when planning the monitoring programme.
— tunnels;
— large underground structures;
— deep basements;
— slopes and earth retaining structures;
— ground improvements.
4.6 Maintenance
(1)P The maintenance required to ensure the safety and serviceability of the structure shall be specified.
NOTE Normally this is specified to the owner/client.
Section 5 gives very basic provisions for ‘unnatural ground’, i.e. situations in which fill is placed
or ground is improved by geotechnical processes.
Although the provisions are sound, they do not provide enough information to define the
design process. More detailed and generally more helpful information can be found in the
following references:
**
Section 6 is the first of a series of sections dealing with the major elements of construction
that require geotechnical design. Each of these has the same basic list of clauses, with further
explanation shown here in italics:
• General (scope);
• Limit states (that could occur and so should be considered);
• Actions and design situations (that the structure should be able to accommodate);
• Design and construction considerations (including buildability);
• Ultimate limit state design;
• Serviceability limit state design;
• Structural design;
• Other particular clauses are added at the end or earlier.
Because it deals with a very common form of foundation, most of the text of Section 6 is
included here.
6.1 General
(1)P The provisions of this Section apply to spread foundations including pads, strips and rafts.
The term spread foundations is preferred to shallow foundations because there is no restriction on
the depth below ground level at which these foundations may operate. The essential point of their
definition is that they transfer load to the ground as a direct stress spread over an adequate area.
Thus spread foundations could be several metres ‘deep’ or take the form of pad foundations in the
bottom of a basement many metres below the original ground surface.
(2) Some of the provisions may be applied to deep foundations such as caissons.
1
See Figure X2a.
2
See Figure X2b.
3
See Figure X2c.
4
An example of combined failure in the ground and in the structure could be the structural
failure in bending of a pad or raft foundation because weak, failing ground in the bearing stratum
requires the bearing pressures to be spread further, increasing bending moments. See Figure X2d.
5
Examples of structural ‘failure’ could be cracking due to foundation settlement (SLS) or collapse
of the structure (ULS) due to foundation displacement, even though the ground has not reached
an ultimate failure. Further information can be found in 6.5.5.
(2) The actions listed in 2.4.2(4) should be considered when selecting the limit states for calculation.
(3) If structural stiffness is significant, an analysis of the interaction between the structure and the
ground should be performed in order to determine the distribution of actions.
It can be debated whether stresses found in an interaction analysis should be called actions or
action effects. See comments on 2.4.2(1).
Paragraphs (1) and (2) constitute checklists of items relevant to design and construction
considerations. These are provided in a ready-to-use form in Appendix 2.
(1)P When choosing the depth of a spread foundation the following shall be considered:
— possible ground movements and reductions in the strength of the bearing stratum by seepage or
climatic effects or by construction procedures;
— the effects of excavations on nearby foundations and structures;
— anticipated excavations for services close to the foundation;
— high or low temperatures transmitted from the building;
— the possibility of scour;
— the effects of variation of water content due to long periods of drought, and subsequent periods of
rain, on the properties of volume-unstable soils in arid climatic areas;
— the presence of soluble materials, e.g. limestone, claystone, gypsum, salt rocks;
(3) EN-ISO 13793 may be applied for frost protecting measures for building foundations.
EN ISO 13793 provides helpful generic information and worked examples. To avoid problems from
frost, UK Building Regulations (Clause 2E4) require a minimum depth of foundations below ground
level of 450 mm. The same figure is also given by BS 8002 and BS 8103-1:1995.
(4)P In addition to fulfilling the performance requirements, the design foundation width shall take
account of practical considerations such as economic excavation, setting out tolerances, working space
requirements and the dimensions of the wall or column supported by the foundation.
Paragraph (4) is about practical issues of buildability. Paragraph (5) considers alternative
approaches to the design calculations.
(5)P One of the following design methods shall be used for spread foundations:
— a direct method, in which separate analyses are carried out for each limit state. When checking
against an ultimate limit state, the calculation shall model as closely as possible the failure
mechanism, which is envisaged. When checking against a serviceability limit state, a settlement
calculation shall be used;
The method above is fairly easily defined: bearing capacity calculations will be needed for ULS
and settlement calculations for SLS. Commonly, the dimensions of a spread foundation will be
governed by DA1-C2 or SLS.
— an indirect method using comparable experience and the results of field or laboratory
measurements or observations, and chosen in relation to serviceability limit state loads so as to
satisfy the requirements of all relevant limit states;
— a prescriptive method in which a presumed bearing resistance is used (see 2.5).
(6) Calculation models for ultimate and serviceability limit state design of spread foundations on soil
given in 6.5 and 6.6 respectively should be applied. Presumed bearing pressures for the design of
spread foundations on rock should be applied according to 6.7.
Whatever is to be built, it is necessary to check that the site itself is stable, both with and without
the proposed additional loading. On sloping ground, this may include considering the stability of
the slope well beyond the boundaries of the site itself, both up and down slope.
(1)P Overall stability, with or without the foundations, shall be checked particularly in the following
situations:
(2)P For such situations, it shall be demonstrated using the principles described in Section 11, that a
stability failure of the ground mass containing the foundation is sufficiently improbable.
6.5.2.1 General
(1)P The following inequality shall be satisfied for all ultimate limit states:
Vd ≤ Rd (6.1)
This requirement, reflecting requirement 2.5, simply means that the design ultimate bearing
capacity, Rd, (expressed in a vertical direction) shall be no less than the design vertical load on the
foundation, Vd. The design resistance will be affected by the inclination and eccentricity of the
load, as well as by the soil properties.
(3)P Vd shall include the weight of the foundation, the weight of any backfill material and all earth
pressures, either favourable or unfavourable. Water pressures not caused by the foundation load shall
be included as actions.
The comparison between Vd and Rd is made at the interface between the structure and the
ground, at the underside of the foundation. So Vd includes all vertical forces coming from above
the interface.
In undrained clay, the water pressure may change as a result of loading. This is regarded as a
reaction. Existing water pressures, not caused by the loading, are classed as actions and, in some
design approaches, may be subject to factoring. For a discussion of the treatment of water
pressures in EC7 and, in particular, the approach taken to this in the UKNA, see 2.4.6.1.
Annex D provides values for bearing capacity factors, considering also inclination and eccentricity
of the loads, shape of foundation and inclination of the structure/ground interface. For spread
foundations at significant depth, compared to their width, depth correction factors are needed
but they are not provided in Annex D because a common formulation has not been agreed
across Europe. Reference to Chen and McCarron (1991) or Tomlinson and Boorman (2001) is
recommended for these.
Various values for the bearing capacity factors can be found in the literature. The formulation
provided in Annex D is not the most conservative, so it would be unwise to adopt values more
optimistic than those of Annex D.
(2)P An analytical evaluation of the short-term and long-term values of Rd shall be considered,
particularly in fine-grained soils.
(3)P Where the soil or rock mass beneath a foundation presents a definite structural pattern of
layering or other discontinuities, the assumed rupture mechanism and the selected shear strength and
deformation parameters shall take into account the structural characteristics of the ground.
Calculation of bearing capacity in jointed rock is difficult and specialist advice is needed.
(4)P When calculating the design bearing resistance of a foundation on layered deposits, the properties
of which vary greatly between one another, the design values of the ground parameters shall be
determined for each layer.
(5) Where a strong formation underlies a weak formation, the bearing resistance may be calculated
using the shear strength parameters of the weak formation. For the reverse situation, punching failure
should be checked.
A slightly less conservative approach to this problem, developed by Vesic, is presented by Chen
and McCarron (1991).
(6) Analytical methods are often not applicable to the design situations described in 6.5.2.2(3)P,
6.5.2.2(4)P and 6.5.2.2(5). Numerical procedures should then be applied to determine the most
unfavourable failure mechanism.
In general, use of slope stability methods for calculations of bearing capacity is not recommended
because it can give significantly unsafe results. If well performed, finite element or finite difference
computations are preferable.
It should be remembered that this text applies to the derivation of bearing resistance for ULS
calculations. Other available empirical calculations for spread foundations are generally concerned
with settlement rather than ultimate bearing capacity.
It is questionable whether this approach, and the reference to Annex G, belong under the heading
of ULS. The charts in Annex G were taken from BS 8004, where they were intended for use with
unfactored loads, giving settlement less than 0.5% of the width of the foundation. They could be
used, quite reasonably, with ULS, DA1-C2, since the factors on actions in this combination, in the
UKNA, are close to unity.
NOTE The sample method for deriving the presumed bearing resistance for spread foundations on rock given in
Annex G is recommended. When such a method is applied, the design result should be evaluated on the basis of
comparable experience.
Hd ≤ Rd + Rp;d (6.2)
In this requirement, Hd is the design horizontal force potentially causing sliding, Rd is the design
base resistance to sliding and Rp;d is the design value of any passive resistance that is available. As
these are all design values for ULS, partial factors are incorporated in deriving them.
(3)P Hd shall include the design values of any active earth forces imposed on the foundation.
(5) The values of Rd and Rp;d should be related to the scale of movement anticipated under the limit
state of loading considered. For large movements, the possible relevance of post-peak behaviour
should be considered. The value of Rp;d selected should reflect the anticipated life of the structure.
For most purposes, Rp;d can be calculated using the peak strength of the soil, with a characteristic
value (cautiously selected, by definition) reduced by partial factors as specified in the UKNA.
Dense granular soils may exhibit very high angles of shearing resistance which are rarely used in
practice because of a fear of progressive failure in a brittle material; this is a sound approach. The
paragraphs that follow have more about Rd.
(6)P For foundations bearing within the zone of seasonal movements of clay soils, the possibility that
the clay could shrink away from the vertical faces of foundations shall be considered.
(7)P The possibility that the soil in front of the foundation may be removed by erosion or human
activity shall be considered.
(8)P For drained conditions, the design shear resistance, Rd, shall be calculated either by factoring the
ground properties or the ground resistance as follows;
A variant of this equation, (6.3b), has been removed here because it is thought to cause confusion
when the UKNA is being used. The value of V'd will incorporate the partial factors for beneficial
actions (usually 1.0 for permanent actions and 0.0 for variable actions).
**
(9)P In determining V'd, account shall be taken of whether Hd and V'd are dependent or independent
actions.
(10) The design friction angle δ d may be assumed equal to the design value of the effective critical
state angle of shearing resistance, ϕ 'cv;d , for cast-in-situ concrete foundations and equal to 2/3 ϕ 'cv;d
for smooth precast foundations. Any effective cohesion c' should be neglected.
(11)P For undrained conditions, the design shearing resistance, Rd, shall be calculated either by
factoring the ground properties or the ground resistance as follows:
Rd = A'cu;d (6.4a)
or
(12)P If it is possible for water or air to reach the interface between a foundation and an undrained clay
subgrade, the following check shall be made:
Rd ≤ 0,4 Vd (6.5)
Paragraphs (12) and (13) apply in the special case where the vertical pressure from the foundation
is fairly small relative to the strength of the soil or rock. Here, the possibility of the foundation
sliding over the asperities of the surface should be considered (Mortensen, 1983).
(13) Requirement (6.5) may only be disregarded if the formation of a gap between the foundation and
the ground will be prevented by suction in areas where there is no positive bearing pressure.
(2) Unless special care is taken during the works, tolerances up to 0,10 m should be considered.
There is no ‘middle third’ requirement in EC7. Special care is called for if the ULS design resultant
forces pass outside the middle two-thirds of a rectangular footing. The ‘tolerance’ required by
paragraph (2) means, in effect, that the footing should be designed to be adequate even if it is
built 0.1 m short at the critical location; that is, a construction tolerance of 0.1 m should be added
to the design width calculated for bearing capacity when the design loading is highly eccentric.
The comments on 6.8(2) regarding structural design are also relevant.
In some circumstances, settlement [paragraph (1)] or heave [paragraph (3)] can lead to sufficient
deformation in a supported building that collapse occurs. This could relate, for example, to loss of
bearing area on a supporting wall for a floor slab or roof. Paragraph (2) is similar to 6.5.2.4 and
seems to be out of place here.
(2) A presumed bearing pressure may be adopted (see 2.5) provided displacements will not cause an
ultimate limit state in the structure.
(3)P In ground that may swell, the potential differential heave shall be assessed and the foundations
and structure designed to resist or accommodate it.
6.6.1 General
(1)P Account shall be taken of displacements caused by actions on the foundation, such as those listed
in 2.4.2(4).
(2)P In assessing the magnitude of foundation displacements, account shall be taken of comparable
experience, as defined in 1.5.2.2. If necessary, calculations of displacements shall also be carried out.
EC7 intends not to encourage misleading or unnecessary calculation. So, in paragraph (2),
assessment of foundation displacement (settlement, heave or horizontal displacement) may be
based on ‘comparable experience’ (see 1.5.2.2) and calculations are only used ‘if necessary’, which
could be taken to mean if comparable experience does not lead to a confident view. This is taken
up in 6.6.2(16), specifically for settlement of foundations on clays. Whichever approach is used,
precise prediction is not necessary and usually not possible N paragraph (6). What is required is to
check that estimated displacements will not exceed tolerable limits (see 2.4.8 and 2.4.9).
For foundations on soft clay (fairly unusual), paragraph (3) (a Principle) makes displacement
calculations mandatory. For foundations on stiff and firm clays, paragraph (4) advises that
calculations ‘should usually be undertaken’, though this should be read with paragraph (2), which
makes calculations unnecessary where there is clear, comparable experience.
Unfactored values of actions are used for serviceability calculations. Paragraphs (7) and (9) state
that total and differential settlements, and relative rotations of foundations, shall all be considered.
More information on settlement calculations is provided in 6.6.2.
(3)P For soft clays, settlement calculations shall always be carried out.
It is advisable to calculate or consider settlements very carefully if the undrained strength of the
clay is less than about 50 kPa or if the new loading exceeds the clay’s preconsolidation pressure.
(4) For spread foundations on stiff and firm clays in Geotechnical Categories 2 and 3, calculations
of vertical displacement (settlement) should usually be undertaken. Methods that may be used to
calculate settlements caused by loads on the foundation are given in 6.6.2.
(5)P The serviceability limit state design loads shall be used when calculating foundation displacements
for comparison with serviceability criteria.
(6) Calculations of settlements should not be regarded as accurate. They merely provide an
approximate indication.
(7)P Foundation displacements shall be considered both in terms of displacement of the entire
foundation and differential displacements of parts of the foundation.
(8)P The effect of neighbouring foundations and fills shall be taken into account when calculating the
stress increase in the ground and its influence on ground compressibility.
(9)P The possible range of relative rotations of the foundation shall be assessed and compared with the
relevant limiting values for movements discussed in 2.4.9.
6.6.2 Settlement
(1)P Calculations of settlements shall include both immediate and delayed settlement.
Application rules in this section describe the basic principles of conventional calculation of
settlement, as found in many textbooks, without giving details of calculations. They are therefore
omitted here. Part 2 of Eurocode 7 (BS EN 1997-2) contains in its annexes several methods of
calculating settlement on the basis of in situ tests.
**
(8)P Any possible additional settlement caused by self-weight compaction of the soil shall be assessed.
**
(10)P Either linear or non-linear models of the ground stiffness shall be adopted, as appropriate.
Non-linear models of calculation include oedometric calculations in clays (e.g. Burland et al, 1977;
Tomlinson and Boorman, 2001), empirical relationships such as Burland and Burbidge (1985) and
use of more complex models involving stiffness degradation with strain or shear failure, typically in
finite element programs.
(11)P To ensure the avoidance of a serviceability limit state, assessment of differential settlements and
relative rotations shall take account of both the distribution of loads and the possible variability of the
ground.
(12) Differential settlement calculations that ignore the stiffness of the structure tend to be over-
predictions. An analysis of ground-structure interaction may be used to justify reduced values of
differential settlements.
(13) Allowance should be made for differential settlement caused by variability of the ground unless it
is prevented by the stiffness of the structure.
(14) For spread foundations on natural ground, it should be taken into account that some differential
settlement normally occurs even if the calculation predicts uniform settlement only.
(15) The tilting of an eccentrically loaded foundation should be estimated by assuming a linear bearing
pressure distribution and then calculating the settlement at the corner points of the foundation, using
the vertical stress distribution in the ground beneath each corner point and the settlement calculation
methods described above.
Paragraph (15) offers a method of calculating the tilt of a rigid foundation, implicitly assuming
the adoption of a linear elastic model of the ground. When the stiffness of the ground is relatively
constant over the depth concerned beneath the foundation, an alternative approach is offered
by the formulae for rotation of rigid plates on the surfaces of half spaces. These can be found in
Lambe and Whitman (1979) or Poulos and Davis (1974), for example.
(16) For conventional structures founded on clays, the ratio of the bearing capacity of the ground, at its
initial undrained shear strength, to the applied serviceability loading should be calculated (see 2.4.8(4)).
If this ratio is less than 3, calculations of settlements should always be undertaken. If the ratio is less
than 2, the calculations should take account of non-linear stiffness effects in the ground.
Paragraph (16) allows the use of a conventional ‘overall factor of safety’ approach as a means of
limiting settlements of spread foundations on clays, avoiding the need for calculation. In effect,
it is an application of the ‘comparable experience’ approach of 6.6.1(2), restricting strain by
mobilising only a small component of the soil’s strength; Osman et al (2004) discuss this approach.
It should be read with 6.6.1(3), which requires calculations of settlements for foundations on soft
clays. If overall factors of safety are to be reduced, calculations become necessary, being more
sophisticated if relatively low overall factors are to be used.
6.6.3 Heave
(1)P The following causes of heave shall be distinguished:
(2)P Calculations of heave shall include both immediate and delayed heave.
Advice on design for vibrations can be found in CP 2012-1:1974 and ISO 4866:2010 and in many
textbooks such as O’Reilly and Brown (1991) or Arya et al (1979).
(2) Precautions should be taken to ensure that resonance will not occur between the frequency of the
dynamic load and a critical frequency in the foundation-ground system, and to ensure that liquefaction
will not occur in the ground.
— the deformability and strength of the rock mass and the permissible settlement of the supported
structure;
— the presence of any weak layers, for example solution features or fault zones, beneath the
foundation;
— the presence of bedding joints and other discontinuities and their characteristics (for example
filling, continuity, width, spacing);
(2) Spread foundations on rock may normally be designed using the method of presumed bearing
pressures. For strong intact igneous rocks, gneissic rocks, limestones and sandstones, the presumed
bearing pressure is limited by the compressive strength of the concrete foundation.
NOTE The recommended method for deriving presumed bearing resistances for spread foundations on rock is
given in Annex G.
Annex G presents not so much a method as a series of charts derived from BS 8004.
(3) The settlement of a foundation may be assessed on the basis of comparable experience related to
rock mass classification.
The comments under 2.4.7.3.4.2 consider the application of ULS Design Approach 1 in structural
design. Commonly, the dimensions of a spread foundation may be governed by DA1-C2 or SLS.
However, once the dimensions have been fixed, the structural strength of the foundations should
be checked using factored structural loads, which are consistent with DA1-C1.
(2) The bearing pressure beneath a stiff foundation may be assumed to be distributed linearly. A more
detailed analysis of soil-structure interaction may be used to justify a more economic design.
A linear distribution of bearing pressure is allowed for the purpose of calculating structural stresses
due to ULS design actions; examples are shown in Figure X3. This should not be confused with the
more plastic approach taken for verification of the ULS of bearing failure, as shown in Annex D
of BS EN 1997-1. It is possible, and allowable, that the resultant of the factored loads could pass
outside the middle third of the foundation (e.g. in DA1-C1; see 6.5.4). In this case, it should not be
assumed that tension can exist between the footing and the ground, and a distribution as shown
in Figure X3(c) should be used.
(3) The distribution of bearing pressure beneath a flexible foundation may be derived by modelling the
foundation as a beam or raft resting on a deforming continuum or series of springs, with appropriate
stiffness and strength.
(4)P The serviceability of strip and raft foundations shall be checked assuming serviceability limit state
loading and a distribution of bearing pressure corresponding to the deformation of the foundation and
the ground.
(5) For design situations with concentrated loads acting on a strip or raft foundation, forces and
bending moments in the foundation may be derived from a subgrade reaction model of the ground,
using linear elasticity. The moduli of subgrade reaction may be assessed by a settlement analysis with
an appropriate estimate of the bearing pressure distribution. The moduli may be adjusted so that the
computed bearing pressures do not exceed values for which linear behaviour may be assumed.
(6) Total and differential settlements of the structure as a whole should be calculated in accordance
with 6.6.2. For this purpose, subgrade reaction models are often not appropriate. More precise
methods, such as finite element computations, should be used when ground-structure interaction has
a dominant effect.
(2) In soils susceptible to disturbance, such as clay, the sequence of excavation for a spread foundation
should be specified to minimise disturbance. Usually it is sufficient to excavate in horizontal slices. In
cases where heave is to be controlled, excavation should be in alternate trenches, the concrete being
cast in each trench before excavating intermediate ones.
Section 7 considers the design of axially loaded piles in both compression (the most common case)
and tension, laterally loaded piles and the effects of ground movements such as those that cause
downdrag (negative skin friction). However, in this book only piles in compression will be considered.
Most nations have found it necessary to change the CEN default values for the resistance factors
of piles, generally increasing them (see the note on ‘recommended values’ in ‘Values of partial
factors’ in the Preface). In the UK, studies have been undertaken to compare the sizes of piles
designed using EC7 with those designed using more traditional methods. As would be expected,
some differences have been noted but, on balance, the different approaches have been found to
be comparable (e.g. Bond and Simpson 2009–10). Structural design of piles should conform to
EC2, for which some details are still under debate, following reports that results may show greater
deviations from past practice in some cases.
7.1 General
(1)P The provisions of this Section apply to end-bearing piles, friction piles, tension piles and transversely
loaded piles installed by driving, by jacking, and by screwing or boring with or without grouting.
(2) The provisions of this Section should not be applied directly to the design of piles that are intended
as settlement reducers, such as in some piled raft foundations.
Despite 7.1(2), the UKNA is intended to include design of piled rafts. The definition of the
characteristic ultimate resistance of piles has been set up so that it could be used with a partial
factor of unity for SLS design, following the normal procedure.
Paragraph (1) constitutes a checklist of items relevant to design situations, which is provided in a
ready-to-use form in Appendix 2.
**
This sub-clause deals with design for downdrag (negative skin friction) and other ground
movements that might affect piles. These special cases are not included in this book.
**
— the results of static load tests, which have been demonstrated, by means of calculations or
otherwise, to be consistent with other relevant experience;
— empirical or analytical calculation methods whose validity has been demonstrated by static load
tests in comparable situations;
— the results of dynamic load tests whose validity has been demonstrated by static load tests in
comparable situations;
— the observed performance of a comparable pile foundation, provided that this approach is
supported by the results of site investigation and ground testing.
The essential message of this paragraph is that all pile design has to be based on static load
testing, directly or indirectly. However, design based on testing alone is also not allowed:
supporting calculations or ‘other relevant experience’ are required, in order to eliminate reliance on
unrepresentative test results.
In many cases, a combination of static load tests and calculations will be used or, at least, the
designer should be aware of published or other static load testing in ‘comparable situations’ that
supports the calculations or dynamic tests on which the design relies. In judging ‘comparable
situations’, pile geometry, installation techniques and ground strata should be considered.
It is also permitted to design on the basis of the observed performance of existing piles, provided
the comparison is shown to be directly relevant, including the installed geometry of the pile, the
actual applied loads and an assessment of the displacements arising from them.
(2) Design values for parameters used in the calculations should be in general accordance with
Section 3, but the results of load tests may also be taken into account in selecting parameter values.
Besides being consistent with the general guidance of Section 3, design values should also be in
accordance with Section 2 and, for construction in the UK, with the UKNA.
(3) Static load tests may be carried out on trial piles, installed for test purposes only, before the design
is finalised, or on working piles, which form part of the foundation.
(2)P In selecting calculation methods and parameter values and in using load test results, the duration
and variation in time of the loading shall be considered.
(3)P Planned future placement or removal of overburden or potential changes in the ground-water
regime shall be considered, both in calculations and in the interpretation of load test results.
Paragraphs 7.4.2 4(P) and (5) constitute checklists of items to be considered in choosing an
appropriate type of pile. These are provided in a ready-to-use form in Appendix 2.
**
7.5.1 General
(1)P Pile load tests shall be carried out in the following situations:
— when using a type of pile or installation method for which there is no comparable experience;
— when the piles have not been tested under comparable soil and loading conditions;
— when the piles will be subject to loading for which theory and experience do not provide sufficient
confidence in the design. The pile testing procedure shall then provide loading similar to the
anticipated loading;
— when observations during the process of installation indicate pile behaviour that deviates
strongly and unfavourably from the behaviour anticipated on the basis of the site investigation or
experience, and when additional ground investigations do not clarify the reasons for this deviation.
7.5.1(1)P lists situations in which it is a code requirement that load testing shall be carried out,
though this is qualified slightly by 7.5.1(3). The arrangement of the sub-clause headings implies
that the tests need not necessarily be static load tests but the author recommends that this should
normally be the case.
**
(3) Where load tests are not practical due to difficulties in modelling the variation in the load (e.g. cyclic
loading) very cautious design values for the material properties should be used.
Paragraph (3) could be misleading if taken literally, since the designer does not have direct control
over design values. Like paragraph (4), it should be understood to remind the designer that the
characteristic value of the pile resistance is intended to be cautious (2.4.5.2(2)), so special care will
be needed if there is a lack of relevant load testing. This issue underlies the approach taken in the
UKNA to derivation of characteristic resistance by calculation (A.3.3.2 of the UKNA).
(4)P If one pile load test is carried out, it shall normally be located where the most adverse ground
conditions are believed to occur. If this is not possible, an allowance shall be made when deriving the
characteristic value of the compressive resistance.
(5)P If load tests are carried out on two or more test piles, the test locations shall be representative of
the site of the pile foundation and one of the test piles shall be located where the most adverse ground
conditions are believed to occur.
The qualification stated for paragraph (4) in cases where it is not possible to test a pile located in
the most adverse ground conditions also applies to paragraph (5).
**
A ‘static’ load test is one in which the load is applied sufficiently slowly that no dynamic effects
are involved. This would not exclude a ‘constant rate of penetration’ (CRP) test in which the pile is
pushed slowly, but continuously, into the ground. However, the CRP test is excluded in the UKNA
by the requirement of a ‘maintained load’ test.
The sub-clauses below refer to tests on trial piles and working piles. In this book, this terminology
is discussed further in the comments on A.3.3.2 of the UKNA.
Load testing in the UK should normally be carried out in accordance with the ICE Specification for
piling and embedded retaining walls (‘SPERWALL’, Institution of Civil Engineers, 2007).
Paragraph (1) says that, for trial piles, it shall be possible to draw conclusions about the ultimate
failure load, but it does not say that the pile shall be loaded to failure; it appears that a cautious
extrapolation of results that do not reach failure could be allowable. In contrast, paragraph (4) says
that, for tensile load tests, no extrapolation is allowed. The methods of Chin (1970) or Fleming (1992)
could be considered for this extrapolation but it is recommended that the maximum limit of the
extrapolation should be a settlement of 10% of the diameter of the pile, consistent with 7.6.1.1(3).
The UKNA allows a reduction in the value of the ‘model factor’ to be applied to calculations if a
maintained load test has been taken to ‘the calculated, unfactored ultimate resistance’ (UKNA,
A.3.3.2). This does not allow extrapolation but does not require the pile to be loaded beyond the
value required to verify the design, even if this has not reached failure.
**
(4) Pile load tests for the purpose of designing a tensile pile foundation should be carried out to failure.
Extrapolation of the load-displacement graph for tension tests should not be used.
The UKNA (A.3.3.2) gives values for the model factor and partial resistance factors dependent on
the number of pile loading tests undertaken on the site. Nevertheless, the following paragraphs
are mandatory principles of EC7 and should therefore be applied.
(1)P The number of trial piles required to verify the design shall depend on the following:
5
See: ISSMFE Subcommittee on Field and Laboratory Testing, Axial Pile Loading Test, Suggested Method. ASTM Journal,
June 1985, pp. 79-90.
(2)P The ground conditions at the test site shall be investigated thoroughly. The depth of borings or
field tests shall be sufficient to ascertain the nature of the ground both around and beneath the pile
tip. All strata likely to contribute significantly to pile behaviour shall be investigated.
(3)P The method used for the installation of the trial piles shall be fully documented in accordance
with 7.9.
(2)P The test load applied to working piles shall be at least equal to the design load for the foundation.
It is unclear what is meant in paragraph (2) by ‘design load’. In this book, the comments on A.3.3.2
of the UKNA relate to typical UK practice.
The use of dynamic load testing is allowed provided the method has been carefully calibrated
against static load tests.
(1) Dynamic load tests6 may be used to estimate the compressive resistance provided an adequate site
investigation has been carried out and the method has been calibrated against static load tests on the
same type of pile, of similar length and cross-section, and in comparable soil conditions, (see 7.6.2.4
to 7.6.2.6).
(2)P If more than one type of dynamic test is used, the results of different types of dynamic test shall
always be considered in relation to each other.
(3) Dynamic load tests may also be used as an indicator of the consistency of the piles and to detect
weak piles.
Sub-clause 7.5.4 constitutes a checklist of items to be included in a load test report. This is
provided in a ready-to-use form in Appendix 2. More comprehensive lists are provided by the
Institution of Civil Engineers (2007).
**
6
See: ASTM Designation D 4945, Standard Test Method for High-Strain Dynamic Testing of Piles.
In contrast to the requirements of 7.4.1, sub-clauses 7.6.2.2 and 7.6.2.3 consider separately design
based on testing and design based on calculation. Typical UK design uses a combination of these
two. For piles in compression, the UKNA accommodates this by starting from 7.6.2.3, ‘Ultimate
compressive resistance [calculated] from ground test results’ and amending the factors required in
the light of the amount of testing carried out – see comments on A.3.3.2 of the UKNA.
7.6.1 General
(2) Normally the design should consider the margin of safety with respect to compressive or tensile
resistance failure, which is the state in which the pile foundation displaces significantly downwards or
upwards with negligible increase or decrease of resistance (see 7.6.2 and 7.6.3).
(3) For piles in compression it is often difficult to define an ultimate limit state from a load settlement
plot showing a continuous curvature. In these cases, settlement of the pile top equal to 10% of the
pile base diameter should be adopted as the “failure” criterion.
(4)P For piles that undergo significant settlements, ultimate limit states may occur in supported
structures before the resistance of the piles is fully mobilised. In these cases a cautious estimate of the
possible range of the settlements shall be adopted in design.
NOTE Settlement of piles is considered in 7.6.4
(2) Where there is a possibility of instability, failure surfaces both passing below the piles and
intersecting the piles should be considered.
(3)P Failure due to uplift of a block of soil containing piles shall be checked in accordance with
7.6.3.1(4)P.
7.6.2.1 General
(1)P To demonstrate that the pile foundation will support the design load with adequate safety against
compressive failure, the following inequality shall be satisfied for all ultimate limit state load cases and
load combinations:
**
(3)P For piles in groups, two failure mechanisms shall be taken into account:
The design resistance shall be taken as the lower value caused by these two mechanisms.
The second of the mechanisms in paragraph (3) is particularly relevant for large groups of piles
in situations where the strength of the ground beneath the group is less than that of the founding
stratum.
(4) The compressive resistance of the pile group acting as a block may be calculated by treating the
block as a single pile of large diameter.
(5)P The stiffness and strength of the structure connecting the piles in the group shall be considered
when deriving the design resistance of the foundation.
(6) If the piles support a stiff structure, advantage may be taken of the ability of the structure to
redistribute load between the piles. A limit state will occur only if a significant number of piles fail
together; therefore a failure mode involving only one pile need not be considered.
(7) If the piles support a flexible structure, it should be assumed that the compressive resistance of the
weakest pile governs the occurrence of a limit state.
Paragraphs (5) to (7) assume a co-ordinated approach to the design of the structure and the piled
foundation. In situations where this is not available, pile designers may have no choice but to
design each pile in isolation, without reliance on stiffness in the structure. Paragraph (6) is most
readily applied to groups of piles supporting a stiff pile cap but can also apply to other structures.
**
(2)P Trial piles to be tested in advance shall be installed in the same manner as the piles that will form
the foundation and shall be founded in the same stratum.
**
(8)P For structures, which do not exhibit capacity to transfer loads from “weak” piles to “strong” piles,
as a minimum, the following equation shall be satisfied:
(
⎧⎪ R c;m
R c;k = Min ⎨
)
mean
(
R c;m ) ⎫
min ⎪
; ⎬ (7.2)
⎪⎩ ξ1 ξ2 ⎪⎭
where ξ 1 and ξ 2 are correlation factors related to the number of piles tested and are applied to the
mean (Rc;m)mean and the lowest (Rc;m )min of Rc;m respectively.
This paragraph allows derivation of the characteristic resistance of piles direct from results of
load tests, without mention of any calculations. It is, however, subject to the general requirement
in 7.4.1(1) that requires calculations as a check. In practice, it may be possible to revise initial
calculations in the light of test results. The values of ξ 1 and ξ 2 to be used for construction in the
UK are provided in the UKNA, Table A.NA.9.
**
(9) For structures having sufficient stiffness and strength to transfer loads from “weak” to “strong”
piles, the values of ξ 1 and ξ 2 may be divided by 1,1, provided that ξ 1 is never less than 1,0.
(10)P The systematic and random components of the variations in the ground shall be recognised in
the interpretation of pile load tests.
(11)P The records of the installation of the test pile(s) shall be checked and any deviation from the
normal execution conditions shall be accounted for.
(12) The characteristic compressive resistance of the ground, Rc;k, may be derived from the
characteristic values of the base resistance, Rb;k, and of the shaft resistance, Rs;k, such that:
(13) These components may be derived directly from static load test results, or estimated on the basis
of ground test results or dynamic load tests.
The values of γ b and γ s to be used for construction in the UK are provided in the UKNA,
Tables A.NA.6 to A.NA.8.
(2) A model factor may be introduced as described in 2.4.1(9) to ensure that the predicted compressive
resistance is sufficiently safe.
(3)P The design compressive resistance of a pile, Rc;d, shall be derived from:
(4)P For each pile, Rb;d and Rs;d shall be obtained from:
The values of γ b and γ s to be used for construction in the UK are provided in the UKNA,
Tables A.NA.6 to A.NA.8.
Paragraphs (5) to (7) of this sub-clause explain how piles may be designed from ground test results
using a similar procedure to that for design from load tests, as given in 7.6.2.2. This approach is
mainly relevant to tests such as cone penetration tests that give a semi-continuous profile at each
tested location and it is not expected to be used much in the UK. The UKNA therefore concentrates
on the ‘alternative’ approach given in paragraph (8).
**
Much of the pile design carried out in the UK follows the procedure of paragraph (8). This is
developed in more detail in the UKNA and further explanation, with examples, can be found in
Bond and Simpson (2009–10). It is a weakness of paragraph (8) that the means by which the
characteristic base and shaft resistances are to be established from ground test results is not stated.
This issue is considered more carefully in the UKNA, sub-clause A.3.3.2. The reader is referred to
that sub-clause and the notes on it in this book.
**
Use of dynamic impact tests is a specialist procedure beyond the scope of this book.
**
Use of pile driving formulae is a specialist procedure beyond the scope of this book.
**
Use of wave equation analysis is a specialist procedure beyond the scope of this book.
**
7.6.2.7 Re-driving
(1)P In the design, the number of piles to be re-driven shall be specified. If re-driving gives lower results,
these shall be used as the basis for ultimate compressive resistance assessment. If re-driving gives
higher results, these may be considered.
(2) Re-driving should usually be carried out in silty soils, unless local comparable experience has shown
it to be unnecessary.
Clearly, 7.6.2.7 only applies to driven piles. Re-driving is also necessary for any base controlled piles
that have been lifted by the subsequent driving of other piles.
**
**
7.6.4.1 General
(1)P Vertical displacements under serviceability limit state conditions shall be assessed and checked
against the requirements given in 2.4.8 and 2.4.9.
(2) When calculating the vertical displacements of a pile foundation, the uncertainties involved in the
calculation model and in determining the relevant ground properties should be taken into account.
Hence it should not be overlooked that in most cases calculations will provide only an approximate
estimate of the displacements of the pile foundation.
NOTE For piles bearing in medium-to-dense soils and for tension piles, the safety requirements for the ultimate
limit state design are normally sufficient to prevent a serviceability limit state in the supported structure.
The note above is very significant. Whereas the Eurocodes generally aim to consider ultimate and
serviceability limit states separately, this note states that for pile design the partial factors used in
the ULS calculation ‘are normally sufficient to prevent a serviceability limit state’. This requirement
has been influential in the choice of partial factors for the UKNA. Nevertheless, for each particular
application, the designer with overall responsibility for the design of the structure should consider
carefully whether the proposed piles will provide adequately stiff foundations.
For the note above, see the comment on the note of 7.6.4.1(2). Paragraphs (2) to (4) make it clear
that an assessment of the likely settlement of the piles under load should be made. This need not
be precise in cases where it is readily established that it will be small enough to be no problem.
(2)P Assessment of settlements shall include both the settlement of individual piles and the settlement
due to group action.
(3) The settlement analysis should include an estimate of the differential settlements that may occur.
(4) When no load test results are available for an analysis of the interaction of the piled foundation
with the superstructure, the load-settlement performance of individual piles should be assessed on the
basis of empirically established safe assumptions.
**
**
The note on structural design in the Preface to this book is relevant here. Often the structural
design of piles will be governed by DA1-C1.
(1)P Piles shall be verified against structural failure in accordance with 2.4.6.4.
(2)P The structure of piles shall be designed to accommodate all the situations to which the piles will be
subjected. These include:
(3)P During structural design, construction tolerances as specified for the type of pile, the action
components and the performance of the foundation shall be taken into account.
(4)P Slender piles passing through water or thick deposits of extremely low strength fine soil shall be
checked against buckling.
(5) Normally a check for buckling is not required when the piles are contained by soils with a
characteristic shear strength, cu, that exceeds 10 kPa.
Paragraph (2) constitutes a checklist of items that should be included in the installation plan. This is
provided in a ready-to-use form in Appendix 2.
**
(3)P It shall be specified that the installation of all piles is monitored and records are made as the piles
are installed.
(4) The record for each pile should include aspects of construction covered in the relevant execution
standards, EN 1536:1999, EN 12063:1999, EN 12699:2000, EN 14199:2005, such as the following:
The remainder of paragraph (4) constitutes a checklist of items that should be included in pile
construction records. This is provided in a ready-to-use form in Appendix 2.
**
(5) Records should be kept for at least a period of five years after completion of the works. As-built
records should be compiled after completion of the piling and kept with the construction documents.
(6)P If site observations or inspection of records reveal uncertainties about the quality of installed piles,
investigations shall be carried out to determine their condition and if remedial measures are necessary.
These investigations shall include either performing a static pile load or integrity test, installing a
new pile or, in the case of a displacement pile, re-driving the pile, in combination with ground tests
adjoining the suspect pile.
(7)P Tests shall be used to examine the integrity of piles for which the quality is sensitive to the
installation procedures if the procedures cannot be monitored in a reliable way.
(8) Dynamic low strain integrity tests may be used for a global evaluation of piles that might have
severe defects or that may have caused a serious loss of strength in the soil during construction.
Defects such as insufficient quality of concrete and thickness of concrete cover, both of which can
affect the long term performance of a pile, often cannot be found by dynamic tests and other tests,
such as sonic tests, vibration tests or coring, may be needed in supervising the execution.
Design of anchorages is a specialist activity outside the scope of this book. Section 8 is currently
being revised. BS 8081, Code of practice for ground anchorages, has been retained for the time
being as a current British Standard.
**
The UKNA to BS EN 1997-1 notes two documents as NCCI relevant to retaining structures, to
which reference is recommended:
PD 6694-1: Recommendations for the design of structures subject to traffic loading to BS EN 1997-1.
and
9.1 General
9.1.1 Scope
(1)P The provisions of this Section shall apply to structures, which retain ground comprising soil, rock
or backfill and water. Material is retained if it is kept at a slope steeper than it would eventually adopt
if no structure were present. Retaining structures include all types of wall and support systems in which
structural elements have forces imposed by the retained material.
(2)P Pressure from granular material stored in silos shall be calculated using EN 1991-4.
9.1.2 defines gravity walls, embedded walls and ‘composite’ walls composed of elements from
both gravity and embedded walls.
**
(2)P In addition, the following limit states shall be considered for gravity walls and for composite
retaining structures:
(3)P For all types of retaining structure, combinations of the above mentioned limit states shall be taken
into account, if relevant.
(4) Design of gravity walls often requires solution of the same types of problem encountered in the
design of spread foundations and embankments and slopes. When considering the limit states, the
principles of Section 6 should therefore be applied, as appropriate. Special care should be taken to
account for bearing resistance failure of the ground below the base of the wall under loads with large
eccentricities and inclinations (see 6.5.4).
9.3.1 Actions
More detailed information on design for traffic loading can be found in PD 6694-1.
**
(2) In ultimate limit state calculations in which the stability of a retaining wall depends on the ground
resistance in front of the structure, the level of the resisting soil should be lowered below the nominally
expected level by an amount Δa. The value of Δa should be selected taking into account the degree
of site control over the level of the surface. With a normal degree of control, the following should be
applied:
— for a cantilever wall, Δa should equal 10 % of the wall height above excavation level, limited to a
maximum of 0,5 m;
— for a supported wall, Δa should equal 10 % of the distance between the lowest support and the
excavation level, limited to a maximum of 0,5 m.
(3) Smaller values of Δa, including 0, may be used when the surface level is specified to be controlled
reliably throughout the appropriate design situation.
(4) Larger values of Δa should be used where the surface level is particularly uncertain.
The requirements of 9.3.2.2 are similar to those of BS 8002, as illustrated in Figure X4. They are
introduced because some embedded retaining walls are very sensitive to small amounts of over-
excavation, scour or erosion. This is particularly the case for walls penetrating into dense soils and
using ‘free earth’ support, for which calculations may show small penetrations (Simpson, 1992).
The additional 10% allowance is a safety margin, akin to a partial factor. It is required for ULS
calculations, which, for DA1, include both Combinations 1 and 2. As is the case with load factors,
this safety margin is not a licence to infringe the characteristic values. It is provided for unforeseen
conditions and should be additional to any reasonably expected erosion or over-excavation, such as
for service trenches.
The allowance is not required for SLS. However, if finite element methods are in use, it may
sometimes be convenient to use the computations for DA1 also for SLS. The 10% allowance
should then be included in the analysis and this will mean that the SLS computations are slightly
more pessimistic than they need to be to satisfy the code.
(2)P Account shall be taken of the effects of variation in permeability on the ground-water regime.
(3)P The possibility shall be considered of adverse water pressures due to the presence of perched or
artesian water tables.
Paragraph (1)P constitutes a checklist of design situations that shall be considered. This is provided
in a ready-to-use form in Appendix 2.
**
9.4.1 General
(1)P Both ultimate and serviceability limit states shall be considered using the procedures described in
2.4.7 and 2.4.8.
(2)P It shall be demonstrated that vertical equilibrium can be achieved for the assumed pressure
distributions and actions on the wall.
Much of the commonly available software for analysis of embedded walls checks horizontal and
moment equilibrium but not vertical equilibrium. However, an imbalance of vertical forces may lead
to collapse (Simpson, 1994).
(3) The verification of vertical equilibrium may be achieved by reducing the wall friction parameters.
(4) As far as possible, retaining walls should be designed in such a way that there are visible signs
of the approach of an ultimate limit state. The design should guard against the occurrence of brittle
failure, e.g. sudden collapse without conspicuous preliminary deformations.
(5) For many earth retaining structures, a critical limit state should be considered to occur if the wall
has displaced enough to cause damage to nearby structures or services. Although collapse of the wall
may not be imminent, the degree of damage may considerably exceed a serviceability limit state in the
supported structure.
Paragraph (5) considers a condition that ‘may considerably exceed a serviceability limit state’,
which seems to be somewhere between serviceability and ultimate limit states. Paragraph (6)
says that the Eurocodes methods and factors ‘are usually sufficient to prevent the occurrence of
ultimate [italics added] limit states in nearby structures’. This may be contrasted with the note
on 7.6.4.1(2) which says, for pile design: ‘the safety requirements for the ultimate limit state
design are normally sufficient to prevent a serviceability limit state in the supported structure’. For
retaining structures, an assessment of displacement is required if there are supported structures
susceptible to serviceability limit states, and reliance on the ULS design is not sufficient. The process
of assessing displacement is considered in 9.8.
(6) The design methods and partial factor values recommended by this standard are usually sufficient to
prevent the occurrence of ultimate limit states in nearby structures, provided that the soils involved are of
at least medium density or firm consistency and that adequate construction methods and sequences are
adopted. Special care should be taken, however, with some highly over-consolidated clay deposits in which
large at rest horizontal stresses may induce substantial movements in a wide area around excavations.
(7) The complexity of the interaction between the ground and the retaining structure sometimes makes
it difficult to design a retaining structure in detail before the actual execution begins. In this case use of
the observational method for the design (see 2.7) should be considered.
Paragraph (8)P constitutes a checklist of items relevant to design of retaining structures, which is
provided in a ready-to-use form in Appendix 2.
**
— a maintenance programme for the drainage system shall be specified and the design shall allow
access for this purpose;
— it shall be demonstrated both by comparable experience and by assessment of any water discharge,
that the drainage system will operate adequately without maintenance.
Inadequate drainage is a frequent cause of failures of retaining walls. The design should facilitate
maintenance of the system, unless there is a very high level of certainty that this is not needed.
(2) The quantities, pressures and eventual chemical content of any water discharge should be taken
into account.
The determination of appropriate earth pressures is critical to the design of retaining structures.
For walls supporting traffic, additional guidance is provided by PD 6694-1. For embedded retaining
walls, reference to CIRIA Report C580 is recommended.
9.5.1 General
(1)P Determination of earth pressures shall take account of the acceptable mode and amount of any
movement and strain, which may occur at the limit state under consideration.
In retaining wall design, this requirement is generally followed either by choosing appropriate
values of earth pressure coefficients or by a ground-structure interaction analysis such as a finite
element model. In either case, partial factors may be incorporated into the parameters adopted if
the analysis is for ULS.
(2) In the following context the words “earth pressure” should also be used for the total earth pressure
from soft and weathered rocks and should include the pressure of ground-water.
Paragraph (3)P constitutes a checklist of items relevant to calculations of the magnitudes of earth
pressures and directions of forces resulting from them, which is provided in a ready-to-use form
in Appendix 2.
**
(4) The amount of mobilised wall friction and adhesion should be considered as a function of:
(5) The amount of shear stress, which can be mobilised at the wall-ground interface should be
determined by the wall-ground interface parameter δ .
(6) A concrete wall or steel sheet pile wall supporting sand or gravel may be assumed to have a design
wall ground interface parameter δ d = k.ϕ cv;d . k should not exceed 2/3 for precast concrete or steel
sheet piling.
In drained soil, the angle of wall friction is related to the ‘constant volume’ or ‘critical state’ angle
of shearing resistance of the soil because it is assumed that construction of the wall may leave the
ground in a disturbed state, loosening initially dense soil.
(7) For concrete cast against soil, a value of k = 1,0 may be assumed.
(8) For a steel sheet pile in clay under undrained conditions immediately after driving, no adhesive or
frictional resistance should be assumed. Increases in these values may take place over a period of time.
(9)P The magnitudes of earth pressures and directions of resultant forces shall be calculated according
to the selected design approach (see 2.4.7.3), and the limit state being considered.
(10) The value of an earth pressure at an ultimate limit state is generally different from its value
at a serviceability limit state. These two values are determined from two fundamentally different
calculations. Consequently, when expressed as an action, earth pressure cannot have a single
characteristic value.
(11)P In the case of structures retaining rock masses, calculations of the ground pressures shall take
account of the effects of discontinuities, with particular attention to their orientation, spacing,
aperture, roughness and the mechanical characteristics of any joint filling material.
(12)P Account shall be taken of any swelling potential of the ground when calculating the pressures on
the retaining structure.
Guidance on swelling pressures in clay fill may be found in O’Connor and Taylor (1994).
(2) For normally consolidated soil, at rest conditions should normally be assumed in the ground behind
a retaining structure if the movement of the structure is less than 5×10-4×h.
(3) For a horizontal ground surface, the at rest earth pressure coefficient, K0, should be determined
from:
( )
K 0 = 1− sinϕ ' × OCR (9.1)
The formula should not be used for very high values of OCR.
In practice, it is often difficult to know the OCR of overconsolidated soils. It may be better to
measure K0 in situ or to consult literature relevant to the particular soil deposit, noting that at
shallow depth below the surface of a stratum, K0 may vary rapidly with depth.
(4) If the ground slopes upwards from the wall at an angle β ≤ ϕ ' to the horizontal, the horizontal
component of the effective earth pressure σ ’h;0 may be related to the effective overburden pressure q’
by the ratio K0;β , where
(
K 0;β = K 0 ⋅ 1+ sin β ) (9.2)
The direction of the resulting force should then be assumed to be parallel to the ground surface.
(2) Limiting values of earth pressure assuming straight failure surfaces can significantly deviate from
the values assuming curved failure surfaces for high angles of shearing resistance and wall-ground
interface parameters δ , and so lead to unsafe results.
NOTE Annex C provides some data of relative movements that cause limiting values of earth pressures.
Besides providing data on ‘movements that cause limiting values of earth pressures’, Annex C
provides values for the coefficients of active and passive pressure that should be used in calculations.
Paragraph (2) means that the Coulomb formulae for active and passive earth pressure should, in
general, not be used. This is particularly so if the angle of wall friction exceeds about one third of
the angle of shearing resistance of the soil, which is usually the case.
(3) In cases where struts, anchorages or similar elements impose restraints on movement of the
retaining structure, it should be considered that the limiting active and passive values of earth pressure,
and their distributions, may not be the most adverse ones.
(2) The intermediate values of earth pressures may be calculated using, for example, various empirical
rules, spring constant methods or finite element methods.
Design could use the theories of Ingold (1979, 1980), which appear in many textbooks and
in PD 6694-1.
(2)P Appropriate compaction procedures shall be specified with the aim of avoiding excessive
additional earth pressures, which may lead to unacceptable movements.
(2)P When checking the ultimate and serviceability limit states, water pressures shall be accounted for
in the combinations of actions in accordance with 2.4.5.3 and 2.4.6.1, considering the possible risks
indicated in 9.4.1(5).
The reference to 2.4.6.1 relates to paragraphs (6) to (8), on which notes are provided in this book.
(3) For structures retaining earth of medium or low permeability (silts and clays), water pressures should
normally be assumed to act behind the wall. Unless a reliable drainage system is installed (9.4.2(1)P), or
infiltration is prevented, the values of water pressures should normally correspond to a water table at
the surface of the retained material.
(4)P Where sudden changes in a free water level may occur, both the non-steady condition occurring
immediately after the change and the steady condition shall be examined.
(5)P Where no special drainage or flow prevention measures are taken, the possible effects of water-
filled tension or shrinkage cracks shall be considered.
9.7.1 General
(1)P The design of retaining structures shall be checked at the ultimate limit state for the design
situations appropriate to that state, as specified in 9.3.3, using the design actions or action effects and
design resistances.
(2)P All relevant limit modes shall be considered. These will include, as a minimum, limit modes of the
types illustrated in figures 9.1 to 9.6 for the most commonly used retaining structures.
(3)P Calculations for ultimate limit states shall establish that equilibrium can be achieved using the
design actions or effects of actions and the design strengths or resistances, as specified in clause 2.4.
Compatibility of deformations shall be considered in assessing design strengths or resistances.
(4)P Upper or lower design values, whichever are more adverse, shall be used for the strength or
resistance of the ground.
(5) Calculation methods may be used, which redistribute earth pressure in accordance with the relative
displacements and stiffnesses of ground and structural elements.
Paragraph (5) makes it clear that various forms of numerical analysis are acceptable for ULS checks.
(6)P For fine grained soils, both short- and long-term behaviour shall be considered.
(7)P For walls subject to differential water pressures, safety against failure due to hydraulic heave and
piping shall be checked.
These issues are considered in more detail in Section 10 of BS EN 1997-1, which is not included in
this book.
(2) As a minimum, limit modes of the types illustrated in figure 9.1 should be considered, taking
progressive failure and liquefaction into account as relevant.
(2) As a minimum, limit modes of the types illustrated in Figure 9.2 should be considered.
Figure 9.1 — Examples of limit modes for overall stability of retaining structures.
Figure 9.2 — Examples of limit modes for foundation failures of gravity walls
Figure 9.3 — Examples of limit modes for rotational failures of embedded walls
(2) As a minimum, limit modes of the types illustrated in Figure 9.3 should be considered.
(3)P The design magnitude and direction of shear stress between the soil and the wall shall be
consistent with the relative vertical displacement, which would occur in the design situation.
(2) As a minimum, the limit mode of the type illustrated in Figure 9.4 should be considered.
(3)P Where downward movement of the wall is considered, upper design values shall be used in
the calculation of prestressing forces, such as those from ground anchorages, which have a vertical
downward component.
(4)P The design magnitude and direction of shear stress between the soil and the wall shall be
consistent with the check for vertical and rotational equilibrium.
Paragraph (4) relates to a common error whereby wall friction from the retained soil is assumed
to support the wall by acting upwards on the wall in checking vertical equilibrium, but is implicitly
assumed to act downwards on the wall in the choice of earth pressure coefficient for the earth
pressure calculation. This is important because friction acting up on the wall, and down on the soil,
considerably increases the coefficient of active pressure.
In checking that there will not be an ultimate limit state, the whole system should be shown to be
in horizontal and vertical equilibrium in a consistent manner. The actual direction of these friction
forces may be uncertain to the designer but the design will usually be safe so long as it is shown to
be fully in equilibrium for a consistent set of forces.
(5)P If the wall acts as the foundation for a structure, vertical equilibrium shall be checked using the
principles of Section 7.
Figure 9.4 — Example of a limit mode for vertical failure of embedded walls
(2) As a minimum, limit modes of the types illustrated in Figure 9.5 should be considered.
Figure 9.5 — Examples of limit modes for structural failure of retaining structures
(3)P For each ultimate limit state, it shall be demonstrated that the required strengths can be mobilised,
with compatible deformations in the ground and the structure.
(4) In structural elements, reduction in strength with deformation due to effects such as cracking of
unreinforced sections, large rotations at plastic hinges or local buckling of steel sections should be
considered in accordance with EN 1992 to EN 1996 and EN 1999.
(1)P It shall be demonstrated that equilibrium can be achieved without pull-out failure of ground
anchorages.
(3) As a minimum, limit modes of the types illustrated in Figure 9.6 (a, b) should be considered.
(4) For deadman anchors, the failure mode illustrated in Figure 9.6 (c) should also be considered.
9.8.1 General
(1)P The design of retaining structures shall be checked at the serviceability limit state using the
appropriate design situations as specified in 9.3.3.
(2) The assessment of design values of earth pressures should take account of the initial stress, stiffness
and strength of the ground and the stiffness of the structural elements.
(3) The design values of earth pressures should be derived taking account of the allowable deformation
of the structure at its serviceability limit state. These pressures need not necessarily be limiting values.
9.8.2 Displacements
(1)P Limiting values for the allowable displacements of walls and the ground adjacent to them shall be
established in accordance with 2.4.8, taking into account the tolerance to displacements of supported
structures and services.
(2)P A cautious estimate of the distortion and displacement of retaining walls, and the effects on
supported structures and services, shall always be made on the basis of comparable experience. This
estimate shall include the effects of construction of the wall. The design may be justified by checking
that the estimated displacements do not exceed the limiting values.
A ‘cautious estimate’ of the displacement of walls is always required. Qualifying this, it should be
noted that the limit state does not require an actual assessment of the displacement but merely
states that it is unlikely to exceed the ‘limiting value’ set in accordance with paragraph (1). In some
cases, it may be relatively easy to conclude that it will not exceed the limit, even though its actual
value is difficult to assess with confidence.
Reliable calculation of the displacement of a retaining wall is generally difficult to achieve. To avoid
unnecessary, and possibly spurious, calculation, EC7 allows the design to be justified by assessment
of displacements on the basis of ‘comparable experience’ (as defined in 1.5.2.2). Usually this will
either mean local experience of similar walls in similar situations or reference to publications such
as CIRIA Report C580, which gives references to other source documents.
For sensitive situations, careful monitoring of retaining wall displacements is often valuable,
though it is not specifically mentioned by the code at this point. This could be linked to use of the
observational method, as described in 2.7.
The following paragraphs have been retained for information, though further development of
them is beyond the scope of this book. They give warning of situations in which specialist analysis
is required.
(3)P If the initial cautious estimate of displacement exceeds the limiting values, the design shall be
justified by a more detailed investigation including displacement calculations.
(4)P It shall be considered to what extent variable actions, such as vibrations caused by traffic loads
behind the retaining wall, contribute to the wall displacement.
(5)P A more detailed investigation, including displacement calculations, shall be undertaken in the
following situations:
— where the wall retains more than 6 m of cohesive soil of low plasticity,
— where the wall retains more than 3 m of soils of high plasticity;
— where the wall is supported by soft clay within its height or beneath its base.
(7)P Displacement calculations shall take account of the stiffness of the ground and structural elements
and the sequence of construction.
(9)P The effect of vibrations on displacements shall be considered with regard to 6.6.4.
Designs that could be subject to hydraulic failure are outside the scope of this book. Nevertheless,
this issue is sometimes very important in those situations to which it is relevant and reference should
then be made to the full text, which is not reproduced here.
Development of a formal procedure for safety provision in situations dominated by water pressure
has proved to be elusive and contentious. It is important that designers consider practically and
imaginatively the possible water pressures that could develop and ensure that they are accommodated
by the design. The UKNA to BS EN 1997-1 notes the following in A.2.1 and repeats similar text when
providing values for partial factors related to water pressures:
The partial factors specified in the National Annex to BS EN 1990:2002 might not be
appropriate for self-weight of water, ground-water pressure and other actions dependent on
the level of water, see 2.4.7.3.2(2). The design value of such actions may be directly assessed
in accordance with 2.4.6.1(2)P and 2.4.6.1(6)P of BS EN 1997-1:2004. Alternatively, a safety
margin may be applied to the characteristic water level, see 2.4.6.1(8) of BS EN 1997-1:2004.
Further discussion of design for water pressures can be found in Simpson et al (2011).
**
Before developing the design of the elements considered in Sections 6 to 10 and 12, it is necessary
to establish that the construction site (and potentially land beyond the site boundaries) will
essentially be stable as the loading on it changes and the construction works progress. Hence each
of those sections refer to and rely on this Section 11. The section is also relevant to situations in
which new construction has a minimal effect but the stability of an existing slope is important.
11.1 General
(1)P The provisions in this Section shall apply to the overall stability of and movements in the ground,
whether natural or fill, around foundations, retaining structures, natural slopes, embankments or
excavations.
(2) Account should be taken of overall stability clauses, related to specific structures, in Sections 6 to 10
and 12.
Paragraph 11.3(2)P constitutes a checklist of actions and design situations relevant to overall
stability, which is provided in a ready-to-use form in Appendix 2.
Paragraphs (3) to (6) emphasise the critical importance of selecting design water pressures carefully
and cautiously.
**
(2)P The overall stability and movement of ground supporting existing buildings, new structures, slopes
or excavations shall be considered.
(3) In cases where the stability of the ground cannot be clearly verified prior to design, additional
investigations, monitoring and analysis should be specified according to the provisions of 11.7.
(4) Typical structures for which an analysis of overall stability should be performed are:
(5)P If the stability of a site cannot readily be verified or the movements are found to be not acceptable
for the site’s intended use, the site shall be judged to be unsuitable without stabilising measures.
(6)P The design shall ensure that all construction activities in and on the site can be planned and
executed such that the occurrence of an ultimate or serviceability limit state is sufficiently improbable.
(7)P Slope surfaces exposed to potential erosion shall be protected if required, to ensure that the safety
level is retained.
(8) Slopes should be sealed, planted or protected artificially. For slopes with berms, a drainage system
within the berm should be considered.
(9)P Construction processes shall be taken into account as far as they might affect the overall stability
or the magnitude of movement.
(11) The design should follow the general principles of Sections 8 and 9.
The values of partial factors to be used for construction in the UK are provided in the UKNA,
paragraphs A.3.1, A.3.2 and A.3.3.6.
**
(2)P In analysing the overall stability of the ground, of soil or rock, all relevant modes of failure shall be
taken into account.
Paragraphs (3) to (9) give general advice about the requirements of slope stability analyses.
Paragraph (8) relates to existing slopes. These can sometimes be justified on the basis of
observation of their apparent stability, provided that any new works will make them no less stable
and will preferably improve their level of safety. This can sometimes be achieved by providing
drainage to reduce water pressures, for example.
**
(8) Existing failed slopes, which can potentially be reactivated should be analysed, considering circular,
as well as non-circular failure surfaces. Partial factors normally used for overall stability analyses then
need not be appropriate.
**
(10) A slope analysis should verify the overall moment and vertical stability of the sliding mass. If a
method of slices is used and horizontal equilibrium is not checked, the inter-slices forces should be
assumed to be horizontal.
Paragraph (10) sets a critical requirement for the types of analysis that can be used in the method
of slices. Its implication is to preclude use of the ‘Swedish Circle Method’ and ‘Janbu’s simplified
method’. (The Swedish Circle Method is sometimes known as the ‘Fellenius method’ or the
‘Ordinary Method of Slices’.) Janbu’s simplified method has no check on vertical equilibrium. Some
of the fundamentals that underlie this requirement are discussed by Whitman and Bailey (1967)
and by Bromhead (1992).
**
(12) Since a distinction between favourable and unfavourable gravity loads is not possible in assessing
the most adverse slip surface, any uncertainty about weight density of the ground should be
considered by applying upper and lower characteristic values of it.
Paragraph (12) makes it clear that no attempt should be made to partition the sliding mass into
‘favourable’ and ‘unfavourable’ ground. Even when the Design Approach or combination in use
requires different factors on favourable or unfavourable permanent actions, the weight of the
ground is to be considered as a ‘single source’ in the terms of 2.4.2(9).
(13)P The design shall show that the deformation of the ground under design actions due to creep or
regional settlements will not cause unacceptable damage to structures or infrastructure sited on, in or
near the particular ground.
Paragraph (13)P is included in this sub-clause on ultimate limit states although it does not refer
to states of complete mechanism in the ground. Presumably, this is because deformation, creep
or regional settlement might be so severe as to cause severe damage and danger to supported
structures. It is unlikely that slopes that conform to the factors of safety required in the UKNA
would be problematic in this regard. (The UK factors are currently the same as the CEN default
values for this situation.) However, the paragraph is particularly relevant to existing slopes
considered as under paragraph (8).
Design of slopes and cuts in rock masses is not included within the scope of this book.
**
(2)P The stability of the bottom of an excavation shall be checked in relation to the design pore-water
pressure in the ground. For the analysis of hydraulic failure (see Section 10).
(3)P Heave of the bottom of deep excavations due to unloading shall be considered.
(2) Subsidence of the ground due to the following causes should be considered:
(3) Since the analytical and numerical methods available at present do not usually provide reliable
predictions of the deformation of a natural slope, the occurrence of serviceability limit states should be
avoided by one of the following:
Paragraph (3), related to SLS, is similar to 11.5.1(13), which is related to ULS. It is unlikely that
slopes that conform to the full factors of safety required in the UKNA would be problematic in
this regard.
11.7 Monitoring
**
Design of embankments is not included within the scope of this book. More extensive guidance
can be found in BS 6031:2009 (Code of practice for earthworks), which uses the concepts of
this section.
**
**
Annex A (informative)
Design Approach and values of partial, correlation and model factors for
ultimate limit states to be used in conjunction with BS EN 1997-1:2004
Because Annex A of the UKNA provides all the values of partial factors required for geotechnical
design, it is included here almost in full.
Annex A provides values for partial factors γ and correlation factors ξ . It includes values of model
factors for pile design, here termed γ Sd, with some additional comments on use of model factors in
other situations.
**
A.1.2 As stated in NA.2, paragraph 1, only Design Approach 1 is used in the UK for the STR and GEO
limit states. This Annex therefore only provides partial factors appropriate for Design Approach 1.
**
The partial factors specified for permanent actions in this Annex have been established to be consistent
with the principle that a single partial factor can be applied to permanent actions arising from a single
source for the STR and GEO limit states (see Note to 2.4.2(9)P of BS EN 1997-1:2004).
The single source principle is particularly relevant to consideration of water pressures. This affects
A.2.1, A.3.1 and A.5, and the EQU limit state discussed under 2.4.7.2 in this book.
A.2 Partial factors for the equilibrium limit state (EQU) verification
For comment on the EQU limit state calculations, see the notes in this book under 2.4.7.2.
In cases where overturning instability of a structure could occur without the resistance of the ground
being exceeded the partial factors specified in the National Annex to BS EN 1990:2002 can give
an overall factor of safety on overturning lower than that from which confidence has been gained
through past UK practice. In such cases it is recommended that consideration be given to the use of
higher partial factors.
In practice, it is very unlikely that a structure will have an overturning instability (under the EQU
requirements) without the resistance of the ground being exceeded. This would usually require
very high concentrated stresses, which would fail the ground (in the STR/GEO requirements) or,
alternatively, would cause failure in the structure.
The partial factors specified in the National Annex to BS EN 1990:2002 might not be appropriate for
self-weight of water, ground-water pressure and other actions dependent on the level of water, see
2.4.7.3.2(2). The design value of such actions may be directly assessed in accordance with 2.4.6.1(2)P
and 2.4.6.1(6)P of BS EN 1997-1:2004. Alternatively, a safety margin may be applied to the characteristic
water level, see 2.4.6.1(8) of BS EN 1997-1:2004.
The issue of finding design water pressures is discussed in EC7 under 2.4.6.1(6).
The design value of earth pressures should be based on the design value of the actions giving rise to
the earth pressure. For bridge design, in some cases, additional model factors might be required when
evaluating horizontal earth pressures (see A.6.3 of this National Annex).
Derivation of design values for earth pressures will include partial factors; in some cases, these
may have the value 1.0. PD 6694-1 suggests that, for structures supporting traffic loads, it will be
necessary to apply an additional model factor to earth pressures if previously obtained levels of
safety and robustness are to be maintained.
Actions listed in BS EN 1997-1:2004, 2.4.2 for which no values are set in BS EN 1991 may be specified
for a particular project. The values of these actions and their partial factors and combination factors
should be agreed with the client and relevant authorities.
Table A.NA.1 — Partial factors on Actions (γ F) for the equilibrium (EQU) limit state
6WUXFWXUH 9DOXH
%XLOGLQJV 6HH7DEOH1$$$LQWKH1DWLRQDO$QQH[
WR%6(1
%ULGJHV 6HH7DEOH1$$$LQWKH1DWLRQDO$QQH[
WR%6(1
Figure X7 shows the text of the UKNA to BS EN 1990 from NA.2.2 for buildings. For bridges, the
equivalent information, which is more complex and extensive, is given in NA.2.3.
Table A.NA.2 — Partial factors for soil parameters (γ M) for the EQU limit state
Although EQU is primarily concerned with situations where actions are nearly balanced, it will
often be the case that some material strength is used to mitigate the slight imbalance modelled by
the partial factors. It is therefore necessary to have material factors for EQU. For further discussion
on EQU, see notes under 2.4.7.2 in this book. For comment on the use of ϕ 'cv and the derivation
of appropriate design values, see the notes under Table A.NA.4 in this book.
A.3 Partial factors for structural (STR) and geotechnical (GEO) limit states verification
The partial factors required for the design of buildings to ULS STR/GEO were summarised in
Figure X1. For pile design, further factors γ Rd and ξ are needed, as noted below.
6WUXFWXUHW\SH 9DOXH
6HW$ 6HW$
%XLOGLQJV 6HH7DEOH1$$%LQWKH 6HH7DEOH1$$&LQWKH
1DWLRQDO$QQH[WR 1DWLRQDO$QQH[WR
%6 (1 %6 (1
%ULGJHV 6HH7DEOH1$$%LQWKH 6HH7DEOH1$$&LQWKH
1DWLRQDO$QQH[WR 1DWLRQDO$QQH[WR
%6 (1 %6 (1
Figures X8 and X9 show the text of the UKNA to BS EN 1990 from NA.2.2 for buildings. The
Set A1 values in BS EN 1997-1 are called Set B in BS EN 1990, and set A2 are called Set C. For
bridges, the equivalent information, which is more complex and extensive, is given in NA.2.3.
The partial factors specified in the National Annex to BS EN 1990:2002 might not be appropriate for
self-weight of water, ground-water pressure and other actions dependent on the level of water, see
2.4.7.3.2(2). The design value of such actions may be directly assessed in accordance with 2.4.6.1(2)P
and 2.4.6.1(6)P of BS EN 1997-1:2004. Alternatively, a safety margin may be applied to the characteristic
water level, see 2.4.6.1(8) of BS EN 1997-1:2004.
The issue of finding design water pressures is discussed in this book under 2.4.6.1(6).
The design value of earth pressures should be based on the design value of the actions giving rise to
the earth pressure. For bridge design, in some cases, additional model factors might be required when
evaluating horizontal earth pressures, see A.6.3 of this National Annex.
Derivation of design values for earth pressures will include partial factors; in some cases, these
may have the value 1.0. PD 6694-1 suggests that, for structures supporting traffic loads, it will be
necessary to apply an additional model factor to earth pressures if previously obtained levels of
safety and robustness are to be maintained.
Actions listed in BS EN 1997-1:2004 2.4.2 for which no values are set in BS EN 1991 may be specified
for a particular project. The values of these actions and their partial factors and combination factors
might need to be agreed with the client and relevant authorities.
Table A.NA.4 — Partial factors for soil parameters (γ M) for the STR and GEO limit state
6RLOSDUDPHWHU 6\PERO 6HW
0 0
$QJOHRIVKHDULQJUHVLVWDQFH $ γϕÖ
(IIHFWLYHFRKHVLRQ γFÖ
8QGUDLQHGVKHDUVWUHQJWK γFX
8QFRQILQHGVWUHQJWK γTX
$ $SSOLHGWRWDQϕÖDQGWDQϕÖFYDOWKRXJKLWPLJKWEHPRUHDSSURSULDWHWR
GHWHUPLQHWKHGHVLJQYDOXHRIϕÖFYGLUHFWO\
127(7KHYDOXHRIWKHSDUWLDOIDFWRUVKRXOGEHWDNHQDVWKHUHFLSURFDORI
WKHVSHFLILHGYDOXHLIVXFKDUHFLSURFDOYDOXHSURGXFHVDPRUHRQHURXV
HIIHFWWKDQWKHVSHFLILHGYDOXHEXWVHHDOVRWKH1RWHWR3LQ
%6 (1
The same value (1.25) is given for the factors on both angle of shearing resistance and effective
cohesion. This has been controversial because it is generally considered that effective cohesion is
less reliable than the angle of shearing resistance. Paragraph 2.4.5.2(3) notes this fact, and requires
that it be considered in selecting characteristic values.
As discussed in the comments on 2.4.5.2, the symbol ϕ 'cv represents the ‘constant volume’ or
‘critical state’ angle of shearing resistance of a soil (i.e. its angle of shearing resistance in a loose,
disturbed state). It is often possible to be more confident about the value of ϕ 'cv than of any higher
values that might be operative in more compact soil. Furthermore, ϕ ' for compact soil tends to fall
to ϕ 'cv as strains become large, which would usually happen if an ultimate limit state developed.
It is therefore arguable that the design value of ϕ 'cv for ULS calculations could be assessed directly,
without the need for a further reduction factor. If this is done, however, it is important to bear in
mind that the partial factors applied to loads and materials in reality have to provide a sufficient
margin to cover other minor eventualities such as imperfections in geometry or other features of
construction. It is therefore important that a sufficient margin remains for these.
The use of ϕ 'cv is specifically required by EC7 to limit interface friction between structures and soil
(6.5.3(10), 9.5.1(6)). Guidance on selection of values for ϕ 'cv can be found in PD 6694-1.
In Design Approach 1, adopted by the UK, partial resistance factors are, in effect, not used for
bearing and sliding. In a formal sense, BS EN 1997-1, 2.4.7.3.4.2(1) shows that the resistance
factors to be used are set R1, and the annex shows that their values are 1.0.
A.3.3.2 provides the values of partial factors on base and shaft resistance, γ b and γ s, for use with
Section 7 of EC7.
For most aspects of ULS analysis, Design Approach 1, adopted by the UKNA, uses partial factors
on material strength rather than on ‘resistance’. For piles and anchors, however, resistance factors
are used, as noted in 2.4.7.3.4.2(2)P. These factors can also be seen as material factors, chosen for
the specific zones of soil affecting the ultimate resistance of piles, adjacent to the pile shaft and
local to the pile base. One important reason for the use of resistance factors in this case is that
load testing is an important feature of pile design; the tests measure resistance directly, rather than
soil strength.
Pile design in the UK is usually based on calculations that use measured or derived soil properties
(Equation 7.9). The calculations are often supplemented by loading tests. The UKNA provides a
set of factors for use in calculations using material strengths that vary according to the extent of
available loading tests. The model factor γ Rd can be reduced if at least one pile is test loaded to the
calculated, unfactored ultimate resistance (a typical trial pile test). The partial factors on shaft and
base, γ s and γ b, can be reduced if 1% of the piles are tested to 1.5 times the representative load
(a typical working pile test).
Figure X11 illustrates the process required, which is described in the text of the UKNA below. The
calculation model used to derive pile resistance from ground strength is an uncertain one. In this
case, the uncertainty lies in the derivation of the characteristic resistance, and for this reason a
model factor γ Rd has been introduced at this stage in the process. A more detailed discussion can
be found in Bond and Simpson (2009–10).
The possibility of designing based principally on load testing or other forms of testing is also
allowed by the UKNA, with factors provided in A.3.3.3 below. Even if this route is followed,
however, the test results should always be shown by calculation to lie within reasonably expected
bounds, following 7.4.1.
The values of factors provided here are considered to be generally applicable for pile foundations.
However, variation of these factors is permitted in particular circumstances when justified by thorough
consideration and documented experience, and after being agreed, where appropriate, with the client
and other relevant authorities.
For verifications of the structural (STR) and geotechnical (GEO) limit states of pile foundations, the
values of the partial factors on resistance (γ R) should be those given in Table A.NA.6, Table A.NA.7
and Table A.NA.8. These values are used to convert characteristic resistances to design values for
ultimate limit state calculations. They apply irrespective of the process by which the characteristic
resistances are derived.
Characteristic resistances may be derived from static load tests using EN1997-1 7.6.2.2 (7.6.3.2 for
tensile loading), or from ground test results using EN1997-1 Equations 7.8 or 7.9 (7.17 or 7.18 for
tensile loading). When the approach of Equations 7.9 or 7.18 is used to derive the characteristic
resistances, a model factor should be applied to the shaft and base resistance calculated using
characteristic values of soil properties by a method complying with EN1997-1, 2.4.1(6). The value of
the model factor should be 1.4, except that it may be reduced to 1.2 if the resistance is verified by a
maintained load test taken to the calculated, unfactored ultimate resistance.
Table A.NA.6 — Partial resistance factors (γ R) for driven piles for the STR and GEO limit states
5 5ZLWKRXW 5ZLWK
H[SOLFLW H[SOLFLW
YHULILFDWLRQ YHULILFDWLRQ
RI6/6 $ RI6/6 $
%DVH γE
6KDIW γV
FRPSUHVVLRQ
7RWDOFRPELQHG γW
FRPSUHVVLRQ
6KDIWLQWHQVLRQ γVW
$ 7KHORZHUγYDOXHVLQ5PD\EHDGRSWHGDLIVHUYLFHDELOLW\LVYHULILHGE\
Table A.NA.7 — Partial resistance factors (γ R) for bored piles for the STR and GEO limit states
5 5ZLWKRXW 5ZLWKH[SOLFLW
H[SOLFLW YHULILFDWLRQ
YHULILFDWLRQ RI6/6 $
RI6/6 $
%DVH γE
6KDIW γV
FRPSUHVVLRQ
7RWDOFRPELQHG γW
FRPSUHVVLRQ
6KDIWLQWHQVLRQ γVW
$ 7KHORZHUγYDOXHVLQ5PD\EHDGRSWHGDLIVHUYLFHDELOLW\LVYHULILHGE\
ORDGWHVWVSUHOLPLQDU\DQGRUZRUNLQJFDUULHGRXWRQPRUHWKDQRIWKH
FRQVWUXFWHGSLOHVWRORDGVQRWOHVVWKDQWLPHVWKHUHSUHVHQWDWLYHORDGIRU
ZKLFKWKH\DUHGHVLJQHGRUELIVHWWOHPHQWLVH[SOLFLWO\SUHGLFWHGE\D
PHDQVQROHVVUHOLDEOHWKDQLQDRUFLIVHWWOHPHQWDWWKHVHUYLFHDELOLW\
OLPLWVWDWHLVRIQRFRQFHUQ
5 5ZLWKRXW 5ZLWK
H[SOLFLW H[SOLFLW
YHULILFDWLRQ YHULILFDWLRQ
RI6/6 $ RI6/6 $
%DVH γE
6KDIW γV
FRPSUHVVLRQ
7RWDOFRPELQHG γW
FRPSUHVVLRQ
6KDIWLQWHQVLRQ γVW
$ 7KHORZHUγYDOXHVLQ5PD\EHDGRSWHGDLIVHUYLFHDELOLW\LVYHULILHGE\
ORDGWHVWVSUHOLPLQDU\DQGRUZRUNLQJFDUULHGRXWRQPRUHWKDQRIWKH
FRQVWUXFWHGSLOHVWRORDGVQRWOHVVWKDQWLPHVWKHUHSUHVHQWDWLYHORDG
IRUZKLFKWKH\DUHGHVLJQHGRUELIVHWWOHPHQWLVH[SOLFLWO\SUHGLFWHGE\D
PHDQVQROHVVUHOLDEOHWKDQLQDRUFLIVHWWOHPHQWDWWKHVHUYLFHDELOLW\
OLPLWVWDWHLVRIQRFRQFHUQ
ξ 3 on the mean values of the calculated resistances from ground test results;
ξ 4 on the minimum value of the calculated resistances from ground test results;
Table A.NA.9, Table A.NA.10 and Table A.NA.11 give the correlation factor values.
IIRUQ U
ξ
ξ
127()RUVWUXFWXUHVKDYLQJVXIILFLHQWVWLIIQHVVDQGVWUHQJWKWRWUDQVIHU
ORDGVIURP´ZHDNµWR´VWURQJµSLOHVYDOXHVRIξDQGξPD\EHGLYLGHG
E\SURYLGHGWKDWξLVQHYHUOHVVWKDQVHH(1
IIRUQ
ξ
ξ
127()RUVWUXFWXUHVKDYLQJVXIILFLHQWVWLIIQHVVDQGVWUHQJWKWRWUDQVIHU
ORDGVIURP´ZHDNµWR´VWURQJµSLOHVYDOXHVRIξDQGξPD\EHGLYLGHG
E\SURYLGHGWKDWξLVQHYHUOHVVWKDQVHH(1
As noted under Section 8 of EC7, design of ground anchors to EC7 is not recommended at the
present stage of development.
For pre-stressed anchorages and verifications of the structural (STR) and geotechnical (GEO) limit
states, the partial factors to be applied on resistance (γ R) should be as given in Table A.NA.12.
5 5
7HPSRUDU\ γDW
3HUPDQHQW γDS
127(/DUJHUYDOXHVRI5VKRXOGEHXVHGIRUQRQSUHVWUHVVHGDQFKRUDJHV
WRPDNHWKHLUGHVLJQVFRQVLVWHQWZLWKWKRVHRIWHQVLRQSLOHV$
DQG$RUUHWDLQLQJVWUXFWXUHV$DVDSSURSULDWH
Because Design Approach 1 is used, all these resistance factors have the value 1.0.
A.4 Partial Factors for the uplift limit state (UPL) verification
A.5 Partial Factors for actions for the Hydraulic Heave limit state (HYD) verification
The HYD limit state is not included in this book. It should be noted, however, that there appears to
be a printing error in Table A.NA.17: the factor 1.335 for permanent unfavourable actions should
read 1.35.
For the verification of the Hydraulic Heave limit state (HYD) the partial factors on actions (γ F) are as
given in Table A.NA.17.
Table A.NA.17 — Partial factors on actions (γ F) at the Hydraulic Heave (HYD) limit state
A.6.2 For buildings designed using conventional calculation methods, it can be assumed that the
necessary model factors are incorporated in the partial factors given in this Appendix except as
specified in A.6.5 to A.6.6.
A.6.3 For bridges and other structures subject to highway loading, an additional model factor may be
introduced for the evaluation of the earth pressure coefficient K, see PD 6694-1.
A.6.4 Additionally, where the method of analysis of a building or a bridge is innovative, or where
the results of a calculation are of uncertain reliability, model factors may be applied. In such cases the
values should be agreed with the client and relevant authorities. In selecting the values of a model
factor, the principles described in BS EN 1997-1:2004, 2.4.1(8) and 2.4.1(9) should be applied.
A.6.5 Model factors required in pile design are provided in A.3.3.2 and A.3.3.3.
A.6.6 BS EN 1997-1:2004, 8.6(4) requires a model factor to be applied to the SLS value of an
anchorage force to ensure that the resistance of the anchorage is sufficiently safe. The meaning of this
paragraph is being questioned with the Eurocode 7 Maintenance Group. Until clarification is received,
no value for the model factor is recommended by this National Annex.
Appendix 1 Figures
Figure X1 – Summary of the factors required for design of buildings by the UKNA for ULS calculations for STR and GEO
;ĂͿ ;ďͿ
;ĐͿ
;ĚͿ
100%
100%
10%
10%
80
70
60
Factors
Nq
50
Nc
40
Ngamma
30
20
10
0
20 25 30
Phi (deg)
35 40 X4
LȖ
LT
+9
1$9DOXHVIRUWKHV\PEROV¼RI7DEOH$$
1$9DOXHVIRUWKHV\PEROV¼DQGÝRI7DEOH$%
(T *NMVXS *NMLQI 4N Ñ4NL (TD *NMVXS *NMLQI Ñ4N Ñ4NL
(TE
*NMVXS *NMLQI 4N Ñ4NL
127( (LWKHUH[SUHVVLRQRUH[SUHVVLRQDWRJHWKHUZLWKDQGEPD\EHPDGHDVGHVLUHG
127( 7KHFKDUDFWHULVWLFYDOXHVRIDOOSHUPDQHQWDFWLRQVIURPRQHVRXUFHDUHPXOWLSOLHGE\¼*VXSLIWKHWRWDOUHVXOWLQJDFWLRQHIIHFWLVXQIDYRXUDEOHDQG¼*LQILIWKHWRWDOUHVXOWLQJDFWLRQ
HIIHFWLVIDYRXUDEOH)RUH[DPSOHDOODFWLRQVRULJLQDWLQJIURPWKHVHOIZHLJKWRIWKHVWUXFWXUHPD\EHFRQVLGHUHGDVFRPLQJIURPRQHVRXUFHWKLVDOVRDSSOLHVLIGLIIHUHQWPDWHULDOVDUH
LQYROYHG
127( )RUSDUWLFXODUYHULILFDWLRQVWKHYDOXHVIRU¼*DQG¼4PD\EHVXEGLYLGHGLQWR¼JDQG¼TDQGWKHPRGHOXQFHUWDLQW\IDFWRU¼VG$YDOXHRI¼VGLQWKHUDQJHWRFDQEHXVHGLQ
PRVWFRPPRQFDVHVDQGFDQEHPRGLILHGLQWKH1DWLRQDO$QQH[
127( :KHQYDULDEOHDFWLRQVDUHIDYRXUDEOH4NVKRXOGEHWDNHQDV
D 9DULDEOHDFWLRQVDUHWKRVHFRQVLGHUHGLQ7DEOH1$$
Appendix 1 Figures
135
Appendix 1 Figures
Ă Ă
t t
&ϭ &Ϯ
Calculated shaft and base resistance
a model factor should be applied to the shaft and
base resistance … value … 1.4, except that it may
γRd = 1.4 or 1.2 be reduced to 1.2 if the resistance is verified by
a maintained load test taken to the calculated,
unfactored ultimate resistance.
Design shaft and base resistance
'ƌŽƵŶĚ
ƐƵƌĨĂĐĞ
^ƚƌĂƚĂ
^ůŝƉƐƵƌĨĂĐĞ
LIVE GRAPH
&2()),&,(172)3$66,9(35(6685(.S
%($5,1*&$3$&,7<)$&7251J
.S
1J
$1*/(2)6+($5,1*5(6,67$1&(GHJ
Figure X15 – Coefficient of active pressure computed from EC7 C.2 for δ/ϕ'=0
+RUL]RQWDOFRPSRQHQW. Ă
EI
GI
I
Figure X16 – Coefficient of active pressure computed from EC7 C.2 for δ/ϕ'=0.5
LIVE GRAPH
Click here to view
+RUL]RQWDOFRPSRQHQW. Ă
EI
GI
I
Figure X17 – Coefficient of active pressure computed from EC7 C.2 for δ/ϕ'=0.67
LIVE GRAPH
Click here to view
+RUL]RQWDOFRPSRQHQW. Ă
EI
GI
I
Figure X18 – Coefficient of active pressure computed from EC7 C.2 for δ/ϕ'=1.0
LIVE GRAPH
Click here to view
+RUL]RQWDOFRPSRQHQW. Ă
EI
GI
I
Figure X19 – Coefficient of passive pressure computed from EC7 C.2 for δ/ϕ'=0
LIVE GRAPH
Click here to view
EI
+RUL]RQWDOFRPSRQHQW. Ɖ
GI
I
Figure X20 – Coefficient of passive pressure computed from EC7 C.2 for δ/ϕ'=0.5
LIVE GRAPH
Click here to view
EI
+RUL]RQWDOFRPSRQHQW. Ɖ
GI
I
Figure X21 – Coefficient of passive pressure computed from EC7 C.2 for δ/ϕ'=0.67
LIVE GRAPH
Click here to view
EI
+RUL]RQWDOFRPSRQHQW. Ɖ
I
Figure X22 – Coefficient of passive pressure computed from EC7 C.2 for δ/ϕ'=1.0
LIVE GRAPH
EI Click here to view
+RUL]RQWDOFRPSRQHQW. Ɖ
GI
I
BSI publications
BS 5930, Code of practice for site investigations
BS 8103-1, Structural design of low-rise buildings — Code of practice for stability, site investigation,
foundations and ground floor slabs for housing
PD 6694-1: Recommendations for the design of structures subject to traffic loading to BS EN 1997-1
BS ISO 4866, Mechanical vibration and shock — Vibration of fixed structures — Guidelines for the
measurement of vibrations and evaluation of their effects on structures
Other publications
Arya, SC, O’Neill, MW and Pincus, G (1979) Design of structures and foundations for vibrating
machines. Houston: Gulf Publishing Company.
Bolton, MD, Powrie, W and Symons, IF (1990[a]). The design of stiff walls retaining overconsolidated
clay: Part I, short term behaviour. Ground Engineering, Vol. 23, No.1, 34–40. London: Emap Inform.
Bolton, MD, Powrie, W and Symons, IF (1990[b]). The design of stiff walls retaining overconsolidated
clay: Part II, long term behaviour. Ground Engineering, Vol. 23, No.2, 22–28. London: Emap Inform.
Bond, A and Harris, A (2008) Decoding Eurocode 7, London: Taylor & Francis.
Bond, AJ and Simpson, B (2009–10) Pile design to Eurocode 7 and the UK National Annex. Part 1:
Eurocode 7, Ground Engineering, Vol. 42, No. 12, Dec 2009, 27–31. London: Emap Inform; Part 2: UK
National Annex, Ground Engineering, Vol. 43, No. 1, Jan 2010, 28–31. London: Emap Inform.
Bromhead, EN (1992) The stability of slopes. Glasgow: Blackie Academic and Professional.
Burland, JB, Broms, BB and de Mello, VFB (1977) Behaviour of foundations and structures. State of
the art review for Session II, Proceedings of the 9th International Conference On Soil Mechanics and
Foundation Engineering, Tokyo, Vol 2, pp 495–546.
Burland, JB and Burbidge, MC (1985) Settlement of foundations on sand and gravel. Proceedings of the
Institution of Civil Engineers, Part 1, 1985, 78, Dec., 1325–1381. London: Institution of Civil Engineers.
Chen, WF and McCarron, WO (1991) Bearing capacity of shallow foundations. In Fang, HY (ed)
Foundation Engineering Handbook, pp 144–165. New York: Chapman & Hall.
Chin, FK (1970) Estimation of the ultimate load of piles not carried to failure. Proceedings of the
Second Southeast Asian Conference on Soil Engineering, Singapore, vol. 1, pp 81–90.
Department for Communities and Local Government (2007) A Designers’ Simple Guide to BS EN 1997.
http://www.communities.gov.uk/documents/planningandbuilding/pdf/153986.pdf
Department for Communities and Local Government (2010) letter to building control offices and
others. http://www.communities.gov.uk/documents/planningandbuilding/pdf/1454859.pdf
Driscoll, R, Scott, P and Powell, J (2008) EC7 – Implications for UK practice, CIRIA C641. London:
Construction Industry Research and Information Association (CIRIA). http://www.ciria.org/service/Web_
Site/AM/ContentManagerNet/ContentDisplay.aspx?Section=Web_Site&ContentID=8973
Fleming, WGK (1992) A new method for single pile settlement prediction and analysis. Géotechnique,
Vol. 42, No. 3, 411–425. London: Thomas Telford.
Frank, R, Bauduin, C, Driscoll, R, Kavvadas, M, Krebs Ovesen, N, Orr, T and Schuppener, B (2004)
Designers’ Guide to EN 1997-1: Eurocode 7: Geotechnical design – General rules. London: Thomas Telford.
Gaba, AR, Simpson, B, Powrie, W, and Beadman, DR (2003) Embedded retaining walls: guidance
for economic design. CIRIA Report C580. London: Construction Industry Research and Information
Association (CIRIA).
Health and Safety Executive (2000) The collapse of NATM tunnels at Heathrow Airport: A report on the
investigation by the Health and Safety Executive into the collapse of New Austrian Tunnelling Method
(NATM) tunnels at the Central Terminal Area of Heathrow Airport on 20–21 October 1994. Sudbury:
HSE Books.
Ingold, TS (1979) The effects of compaction on retaining walls. Géotechnique, Vol. 29, No. 3, 265–284.
London: Thomas Telford.
Ingold, TS (1980) Lateral earth pressures – a reconsideration. Ground Engineering, May 1980.
Institution of Civil Engineers (2007) ICE Specification for piling and embedded retaining walls,
2nd edition. London: Thomas Telford.
Kerisel, J and Absi, E (1990) Active and passive earth pressure tables. Rotterdam: Balkema.
Lambe, TW and Whitman, RV (1979) Soil Mechanics, SI version. Chichester: John Wiley & Sons.
Magnus, R, Teh, CI and Lau, JM (2005) Report on the Incident at the MRT Circle Line worksite that led
to the collapse of the Nicoll Highway on 20 April 2004. Singapore: Ministry of Manpower.
Mortensen, K (1983) Is limit state design a judgement killer? Sixth Laurits Bjerrum Memorial Lecture,
1982. Publication No. 148. Oslo: Norwegian Geotechnical Institute.
Nicholson, DP, Tse, CM and Penny, EC (1999) The Observational Method in ground engineering:
principles and applications, CIRIA Report 185. London: Construction Industry Research and Information
Association (CIRIA).
O’Connor, K and Taylor, RN (1994) Swelling pressure of compacted clayey fill. TRL Project Report 72.
Crowthorne: Transport Research Laboratory.
O’Reilly, MP and Brown, SF (1991) Cyclic loading of soils: from theory to design. Glasgow: Blackie.
Orr, TLL (2005) Model Solutions for Eurocode 7 Workshop Examples. Proceedings of the International
Workshop on the Evaluation of Eurocode 7, Trinity College, Dublin, 31 March and 1 April 2005. Available
at: http://www.eurocodes.fi/1997/1997-1/background/Evaluation%20of%20Eurocode%207.pdf
Osman, AS and Bolton, MD (2006) Design of braced excavations to limit ground movements.
Proceedings of Institution of Civil Engineers, Geotechnical Engineering 159 (3), 167–175. London: ICE
Publishing.
Osman, AS, Yeow, HC, Bolton, MD (2004) Estimation of undrained settlement of shallow foundations
on London clay. First International Conference on Structural and Foundation Failures, August 2–4,
2004, Singapore
http://www-civ.eng.cam.ac.uk/geotech_new/people/bolton/mdb_pub/148_ICSFF_Singapore_2004.pdf
Peck, RB (1969) Advantages and Limitations of the Observational Method in Applied Soil Mechanics.
Géotechnique, Vol. 19, No. 2, 171–187. London: Thomas Telford.
Poulos, HG and Davis, EH (1974) Elastic solutions for soil and rock mechanics. New York: John Wiley &
Sons. http://www.ce.ncsu.edu/usucger/PandD/PandD.htm
Schuppener B, Simpson, B, Orr, TLL, Frank, R and Bond, AJ (2009) Loss of static equilibrium of a
structure – definition and verification of limit state EQU, in Y Honjo, M Suzuki, T Hara and F Zhang
(eds) Proceedings of the 2nd International Symposium on Geotechnical Safety and Risk, Gifu, Japan,
11–12 June 2009, pp 111–118. London: Taylor & Francis.
Simpson, B (1992) 32nd Rankine Lecture: Retaining structures – displacement and design.
Géotechnique, Vol. 42, No. 4, 539–576. London: Thomas Telford.
Simpson, B (1994) Discussion, Session 4b, Displacements and soil-structure interaction: Earth retaining
structures and deep excavations – Underground retaining structures and deep excavations, in
Associazione Geotecnica Italiana (ed), Proceedings of the Tenth European Conference on Soil Mechanics
and Foundation Engineering, Florence, 26–30 May 1991, Vol. 4, pp 1365–6. Rotterdam: Balkema.
Simpson, B (2007) Approaches to ULS design – The merits of Design Approach 1 in Eurocode 7.
ISGSR2007 First International Symposium on Geotechnical Safety & Risk, Oct. 18–19, 2007, Shanghai
Tongji University, China, pp 527–538.
http://www.eurocodes.fi/1997/1997-1/background/Simpson_2007.pdf
Simpson, B, Morrison, P, Yasuda, S, Townsend, B and Gazetas, G (2009) State of the art report:
Analysis and design, in M Hamza et al (eds), Proceedings of the 17th International Conference on Soil
Mechanics and Geotechnical Engineering: The Academia and Practice of Geotechnical Engineering,
Alexandria, Egypt, 5–9 October 2009. Amsterdam: Millpress Science.
Simpson, B, Nicholson, DP, Banfi, M, Grose, WG and Davies, RV (2008) Collapse of the Nicoll Highway
excavation, Singapore, in BS Neale (ed) Forensic Engineering: From failure to understanding – Papers
prepared for the Fourth International Conference on Forensic Engineering. London: Thomas Telford.
Simpson, B and Powrie, W (2001) Embedded retaining walls: theory, practice and understanding,
Perspective Lecture, in Proceedings of the 15th International Conference on Soil Mechanics and
Geotechnical Engineering, Istanbul. Amsterdam: Balkema.
Simpson, B, Vogt, N and van Seters, AJ (2011) Geotechnical safety in relation to water pressures.
Accepted for Proceedings of the 3rd International Symposium on Geotechnical Safety and Risk, 2–3
June 2011, Munich.
Tomlinson, MJ and Boorman, R (2001) Foundation design and construction, 7th edition. Harlow:
Longman Group.
Uff, JF and Clayton, CRI (1986) Recommendations for the procurement of ground investigation. CIRIA
Special Publication 45. London: Construction Industry Research and Information Association (CIRIA).
Uff, JF and Clayton, CRI (1991) Role and responsibility in site investigation. CIRIA Special Publication 73.
London: Construction Industry Research and Information Association (CIRIA).
Whitman, RV and Bailey, WA (1967) Use of computers for slope stability analysis. Journal of the Soil
Mechanics and Foundations Division, ASCE, Vol. 93, No. SM4, July 1974, pp 475–498.
Wong, HN, Pang, LS, Wong, ACW, Pun, WK and Yu, YF (1999) Application of prescriptive measures to
slopes and retaining walls. Geotechnical engineering office (Hong Kong) Geo report No. 56.