Module 2 Overview: Spring Break
Module 2 Overview: Spring Break
Module 2 overview
lecture lab
1. Introduction to the module 1. Start-up protein eng.
2. Rational protein design 2. Site-directed mutagenesis
3. Fluorescence and sensors 3. DNA amplification
4. Protein expression 4. Prepare expression system
SPRING BREAK
5. Review & gene analysis 5. Gene analysis & induction
6. Purification and protein analysis 6. Characterize expression
7. Binding & affinity measurements 7. Assay protein behavior
8. High throughput engineering 8. Data analysis
2
Ting et al. (2001) Proc. Natl. Acad. Sci. USA 98: 15003-8
single-chain “nanobodies”
bispecific antibodies
Nagai et al. (2004) Proc. Natl. Acad. Sci. USA 101: 10554-9
Courtesy of National Academy of Sciences, U. S. A. Used with permission.
Source: Nagai, T., et al. "Expanded Dynamic Range of Fluorescent Indicators for Ca2+ by Circularly Permuted Yellow Fluorescent Proteins."
PNAS 101, no. 29 (July 20, 2004): 10554-9. DOI: 10.1073/pnas.0400417101. Copyright © 2004 National Academy of Sciences, U.S.A.
9
What weve called “blob-level” design is useful for combining
functionalities associated with individual protein domains–but what if
we want to create new functionalities or make subtle manipulations?
Image removed due to copyright restrictions. Cartoon: A business meeting in which the presenter,
using an overhead transparency projector, puts up the slide "Attention to Detail" and the slide is projecting upside down.
The presenter says, "Which Brings me to my Next Point."
See http://www.cartoonstock.com/cartoonview.asp?search=site&catref=mban740
10
Protein engineering at high resolution
Leatherbarrow et al. (1985) Proc. Natl. Acad. Sci. USA 82: 7840-4
Courtesy of Robin Leatherbarrow. Used with permission.
12
Rational design can also be used to stabilize proteins–general route to
improvement of function/utility
Images from Perry, L. J., and R. Wetzel. "Disulfide Bond Engineered into T4 Lysozyme:
Stabilization of the Protein toward Thermal Inactivation." Science (New Series) 226, no. 4674 (1984): 555-557.
© AAAS. All rights reserved. This content is excluded from our Creative Commons license.
For more information, see http://ocw.mit.edu/fairuse
13
The “holy grail” of rational engineering is to design entire proteins de
novo to fold into a defined shape (and ideally carry out a function)
...
...
...
...
...
...
...
...
Chou & Fasman (1974) Biochemistry 13: 222-45
© American Chemical Society. All rights reserved. This content is excluded from our Creative Commons license.
For more information, see http://ocw.mit.edu/fairuse.
. . . . . .
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
helix <------------------------------> <-------------------
sheet EEEEEEEE EEEEEEEEEEE
turns TT T T T T T T T TT
. .
EVDEMIREADIDGDGQVNYEEFVQMMTAK
helix ----------> <----------->
sheet EEEEEEEEE
turns T T
14
De novo design can be extended to 3° and 4° structure. Example is
design of a functional enzyme from so-called coil-coil peptides:
Kaplan & Degrado (2004) Proc. Natl. Acad. Sci. USA 101: 11566-70
Courtesy of National Academy of Sciences, U. S. A. Used with permission. Source: Kaplan, J., and W. F. DeGrado.
"De Novo Design of Catalytic Proteins." PNAS 101, no. 32 (2004): 11566-70. DOI: 10.1073/pnas.0404387101.
Copyright © 2004 National Academy of Sciences, U.S.A.
15
simulation of
anthrax toxin
dissociating from
its receptor
For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms.