Embracing the Reset Agenda “The strength and resilience of a nation lay within the mindset of its people”

- Boyce Sebetela

Friday June 28, 2024 No. 120 https://dailynews.gov.bw

Botswana ready
Stories
pages 9 - 16
to share success
Business
UB, GA forge
partnership
for sustainable
gaming industry

Page 6

Dikgang
Tshwaragano
e ka fenya
borukutlhi

Tsebe 10

Sport
Zebras face
Bafana Bafana President Dr Mokgweetsi Masisi (right) and Secretary General of the International Institute for Democracy and Electoral Assistance, Dr
Kevin Kasas-Zamora at the inaugural High Level Dialogue on Comparative Mineral Resources Governance in Africa yesterday. President
tomorrow Masisi said by prioritising local value addition and leveraging mineral wealth for broader economic transformation, Botswana continued
to pave way for inclusive growth and sustainable development, and stood ready to share in its relative success. Photo: Thompson Keobaletswe

Page 23 STORY PAGE 3

DailyNews Friday June 28, 2024 No. 120 Page 2

Data, research vital for national development

By Baleseng Batlotleng tech elites, to a resource that was of cancer and innovative drugs,” a major milestone towards Botswana from an upper-middle-
intangible and central to all spheres he said. achievement of the African Data income to high-income country.
TLOKWENG - Data and research of life. Mr Segokgo said the COVID-19 Policy Framework,” he added. For her part, one of the
are part of the national drive He said it was undeniable that pandemic demonstrated that Mr Segokgo said data was at the conference organisers, Ms
towards digital transformation and people were living in the world of there was a need to close the centre of knowledge, which in turn Tuduetso Mokgosi of People and
for national development plans to data where those who were going gap in data inequalities in terms was key for the development of the Gap, said the conference was about
be realised there is need to move to be successful and powerful in of access to data and as well as region. data and its usage in Africa for the
towards evidence-based policy the future were those who were technological capacity in Africa. He highlighted that deliberating benefit of the people. People and
making. able to make great strides and He said there was need to address on the pertinent issues related Gap is dedicated to transforming
Officially opening the People success in data management. data colonialism through improved to navigating the complex data businesses to become more
and Data Conference in Tlokweng “Director of ceremonies, as part awareness on data issues. regulatory issues would help in impactful by providing them with
on Wednesday, the Minister of of these efforts, government will “In 2022 the Africa region, the pursuit of an African agenda insights that inform their decision-
Communications, Knowledge launch its first satellite into orbit through the African Union, that prioritised innovation and making processes for greater brand
and Technology, Mr Thulagano to be used for earth observation. released its Data Policy digitisation. relevance and innovation.
Segokgo said decisions should be This initiative would increase Framework, whose major goal He said it was proper for the Their services include
guided by empirical insights that data generation hence the need is to bolster intra-African digital involved experts to map out within insights, strategy development,
were derived from data at all levels for improved data collation and trade, entrepreneurship, and African knowledge systems the and community engagement.
so that there was prudent use of research. Government has also digital innovation. The Framework place and location of data and Through their work, they impact
national resources. managed to lure and attract also provides for safeguarding associated emerging technologies. communities by crafting brand
Mr Segokgo, who is also different investors with the view against risks and harms of the Minister Segokgo said strategies that consider community
Tlokweng MP, said data had moved to set up and develop vaccine digital economy. This conference government considered data as needs and economic growth
from simply being understood manufacturing plants in the therefore, being supported and the diamond of the future and objectives.
as a resource that was limited to country, particularly in the areas facilitated by Africans, marks that since 2018, several legislative “This conference is an
and policy reforms had been opportunity for us to speak about
taking place, which saw the Data how data can be used to solve
Protection Act come into operation some of the challenges that we
in 2022. are faced with in the region as a
He said the 2021 Smart collective. There is no denying that
Botswana Strategy was an action data has taken over. All sectors of
plan that sought to deliver a smart life and society are driven by data,
sustainable society aligned with hence we need to find data driven
Botswana’s National Vision 2036 solutions for ordinary people,” she
whose goal was to transform said. BOPA

Official calls for

effective service
delivery officers are the backbone of local
By Esther Mmolai
government in delivering service
MAUN - Deputy permanent to Batswana and as such, you
secretary in the Ministry of should been seen linking social
Local Government and Rural assistance programmes with
Development has highlighted the human development services for
need for social and community beneficiaries and helping them
development officers to develop transition into jobs,” she said.
inclusive protection and shock Furthermore, Ms Kamanakao
interventions that will help to build urged participants to accelerate
resilient communities. efforts to promote social change,
Minister Segokgo (left) and Ms Mokgosi at the People and Data Africa Conference in Tlokweng on Wednesday. Officially opening the Hukuntsi social justice as well as eradicate
The minister said data and research were part of the national drive towards digital transformation. District Council Social and poverty in the society through
Photo: Godfrey Mpuse Community Development retreat empowering the communities to
in Maun on Wednesday, Ms be self-reliant.
Mamikie Kamanakao said it was “We need to also change the

Boteti District chairperson urges therefore important for officers

to familiarise themselves with
the National Social Protection
way we have been doing things
and align with what the citizens
are looking for and what the

perseverance against challenges Framework (NSPF) for easier

coordination of social protection
programmes.
ministry wants in order to achieve
through implementation of the
strategy and the framework,” she
said.
“Gone are the days where we
By Thandy Tebogo benefitted meaningfully through said, would construct a block of focused much on compiling reports She appreciated the newly
partnership with sponsors like three classrooms at Makgaba that show increasing number of upgraded council for its
LETLHAKANE - Boteti Debswana Mining Company, during 2024 with implementation destitute persons. We also need to performance, saying ‘it is the first
District, though faced with limited Lucara Botswana and Dream expected to commence next move away from the silo mentality district and a trendsetter in driving
resources, has to execute council Choice on execution of impactful month. because we are all working towards Chema Chema initiative’.
business and deliver timely projects. Mr Galeragwe said the project one goal which is to develop Welcoming participants, North
service to Batswana. Mr Galeragwe said into 2024, would reduce distance travelled human beings and I challenge you West District Council secretary,
The council chairperson Debswana donated a kilometre by children as well as promote to embrace change and move away Mr Thatayotlhe Balapi urged
Mr Molemi Galeragwe told paving of internal road at Rakops education and skills development from welfare to workfare as that is officers to embrace change and
councillors during a session in at a cost of P4 million to facilitate as per vision 2036 pillar two of where the world is going,” she said. promote social inclusion and
Letlhakane on Monday that the accessibility and improve human and social development. Ms Kamanakao also challenged economic empowerment among
district was obliged to partake in infrastructure development. In addition Lucara Botswana the officers to understand the the communities. BOPA
government intentions irrespective Orapa Letlhakane and through the Corporate Social ministry’s Strategic Transformation
of challenges encountered. Damtshaa Mines through Safety Investment donated Information Plan and the NSPF and use them as
He through the Reset Agenda, and Sustainable Development and Technology equipment to guiding tools to assist the ministry Sir Seretse Khama Day
intention of government was department made a donation of 34 schools in Boteti region. The to improve its performance.
to have an effective working eight solar streetlights worth P140 donated items included 34 printers “The NSPF facilitates a shift activities in Gaborone
infrastructure and systems with 000 at Moremaoto. and 68 computers. towards a life cycle perspective
competitive skilled citizens. He said Debswana would also Abaricom pledged to connect to identify how social protection Date: July 1, 2024
The district, he said, was construct a two-classroom block at Internet in schools, he said, adding could be and currently does to
growing as evidenced by the Mmeya at a cost of P2.6 milion to that there was a Memorandum of Venue: Parliament Grounds
protect the vulnerable society,” she
number of public officers in the alleviate shortage of classrooms. Agreement between the education added. Time: 8am to 12:30pm
district, and hoped such would go Mr Galeragwe stated that ministry, Boteti District Council, She further urged participants Key Speakers: President Dr
a long way in enhancing provision another upcoming project by Lucara and Abaricom. The to introspect and ensure that they
of services to local communities. Debswana was refurbishment of partnership covers maintenance aligned their services, operations Mokgweetsi Masisi
He pleaded with other theatre wing at Rakops Primary of computers and printers. He with the ministry’s strategic plan Former President of
ministries, service providers, Hospital at total cost of P4.2 said Dream Choice donated and the NSPF.
parastatals, non-governmental million to improve clinical construction one block of two “We should be efficient and Mozambique, Dr Joaquim
and government organisations to outcomes of emergencies in classrooms at Retlhatloleng effective in what we are doing in Chissano
continue decentralising services Boteti. Primary School in Letlhakane. order to give Batswana results.
to the district. He said Boteti Further Lucara Botswana, he BOPA Social and community development
 Friday June 28, 2024 No. 120 Page 3 DailyNews

‘Unlocking Africa’s
natural resources
potential critical’
By Baleseng Batlotleng continuous and uninterrupted
elections underpinned by an anti-
GABORONE - By diversifying corruption culture,” he said.
economies, promoting value He said it was important to
addition and creating an enabling highlight the role that legislation
environment for industrial played in the successful
growth, Africa can unlock the full implementation of the country’s
potential of its natural resources socio-economic development
and participate more effectively in vision.
global value chains, thus driving Dr Masisi said Botswana’s
sustainable development and mining legislation stood out as one Minister of Agriculture, Mr Fidelis Molao (left) and Mr Boutillier (right) being taken through the Residue
prosperity for its people. of the oldest and most advanced Chemistry Laboratory by research scientist, Mr Sandy Mookantse (centre) during the unveiling of new
President Dr Mokgweetsi Masisi frameworks on the continent. meat residue testing equipment at Botswana National Veterinary Laboratory at Sebele on Wednesday.
made the observation yesterday “It dates back to the 1969 Mr Boutillier commended Botswana for staying committed to localising testing of residues in order to
when officially opening a High Mines and Minerals Act, which reduce the turnaround times and to allow for timely interventions. Photo: Tshoganetso Mokowe
Level Continental Dialogue on underwent significant amendments

Equipment to boost beef exportation

Comparative Mineral Resource in 1970, to bolster state oversight
Governance in Africa. of minerals and revenue collection.
He said factors such as This robust legal framework
inadequate infrastructure, limited not only guides the sustainable
access to capital and technology, management of mineral resources, By Thato Mosinyi for acceptability of beef from Mr Boutillier additionally said
lack of skilled labour, governance but also reinforces transparency Botswana into the EU and other the EU-SADC EPA programme
issues, and extractive oriented and ensures that the mining sector’s GABORONE - Botswana’s international markets. was mindful that Botswana could
economic models, had all benefits contribute meaningfully efforts to comply with the In order to meet the localisation only attain high income status
contributed to Africa’s reliance to Botswana’s overall development European Union meat market residue testing, Mr Boutillier through strong partnerships
on exporting raw materials rather agenda,” he said. requirements received a major highlighted that the laboratory had with key industry players, which
than processing and adding value President Masisi recognised boost through the donation of to be capacitated to cover costs would increase Botswana’s
to them locally. He said addressing the prevailing challenges faced an over P7 million meat residue of setting up residue monitoring competitiveness and increase
the challenges required a holistic by many African countries due to testing equipment. tests, which involved equipment foreign direct investment in the
approach that involved promoting the ‘resource curse’, where natural The laboratory equipment, a purchasing and training of staff. country.
industrialisation, investing in resources particularly minerals had donation through the European “Through this noble laboratory He said the EU had since 2021
education and skills development, led to internal divisions rather than Union-SADC Economic equipment hand over, we are not injected over P88 million into the
fostering innovation and technology fostering national development Partnership Agreement (EPA) is only enhancing the capacity of project with the main objectives
transfer, improving infrastructure, and unity. He said Botswana took aimed at positioning Botswana as the national laboratory but we being to increase export to the EU
enhancing governance and pride in its track record of avoiding a reference centre of excellence are also supporting the entire to support Botswana’s economic
regulatory frameworks, and the negative label associated with for residue testing in the SADC agricultural sector since Botswana diversification drive.
fostering partnerships between some mineral rich nations but had region. will be better positioned to expand For his part, National
governments, private sector and not been immune to the challenges Speaking during the laboratory exports, create jobs and drive Agricultural Research and
international organisations. that often accompanied such testing equipment hand over economic growth,” he said. Development Institute, Chief
“Botswana stands as an outlier endowments. in Gaborone Wednesday, EU’s Mr Boutillier said the EU had Executive Officer, Professor
to a fair portion of what has He said the conference presented chargé d’affaires to Botswana and noted great efforts by government Julius Atlhopheng said residues
become a negative global narrative a timely opportunity for the the SADC region, Mr Clement to improve beef value chain section was a food safety section
relating to the correlation between continent to join forces in ensuring Boutillier said the EU had through and beef quality through the of Botswana National Veterinary
endowment with natural resources, that the benefits of development its audit system identified a gap in importation of high beef cattle Laboratory under the animal
and the expected development reached all citizens, leveraging the the implementation of Botswana’s pedigree as well as the intent to production and health department
dividend. Botswana stands ready potential of valuable natural assets National Residue Plan since it was increase national livestock herd. at NARDI. The section, he said,
to humbly offer its experience as for progress and prosperity. done abroad, hence the donation. Thus, he said the donated was mandated to monitor the levels
one that illustrates that mineral The inaugural meeting is He commended Botswana for equipment represented a crucial of residues of veterinary drugs
resources if well managed, have held under the theme: Towards staying committed to localising step in ensuring that Botswana and hormones and environment
the potential to improve a nation’s Sustainable Development: testing of residues in order to beef reached the required EU contaminants (pesticides and
economic and social development Harnessing Africa’s Mineral reduce turnaround times to allow markets standards since the heavy metals) in meat and meat
trajectory,” he said. Wealth for Economic Growth, for timely interventions, adding interim EPA gave goods from products, water, feed and other
Dr Masisi said Botswana’s Social Equity, and Environmental that the donated equipment Botswana duty free and quota free biological samples destined for
unique position as a country Responsibility. BOPA would thus ensure compliance access into the EU market. human consumption. BOPA
that had effectively managed its
mineral resources for sustainable
development served as a valuable
example for others facing similar
challenges.
Botswana ready to share success
By Baleseng Batlotleng all underscore the principle of region,” he said. strategic policies, Botswana had
He said sharing Botswana’s
integrated development at their The President further said achieved high rankings in various
experiences and best practices
GABORONE - Botswana core,” he said. Botswana was poised to share its global mining-related indices.
could be beneficial for fostering
continues to pave the way for Such frameworks, he said, were experiences in various key areas, “In Africa, Botswana stands
dialogue, knowledge exchange and
inclusive growth and sustainable further reinforced by initiatives such as advancing sound mining out, with the Fraser Institute
capacity building among nations
development by prioritising value and visions such as the UNDP’s legislation for holistic national Policy Perception Index crowning
seeking to maximise the benefits
addition locally and leveraging Sustainable Development development, negotiating diamond it as the top-ranked country.
of their natural resources.
mineral wealth for broader Framework, United Nations sales agreements to empower Moreover, Botswana secured
He said through collaboration
economic transformation. Economic Commission for mining countries, utilising the second position in the Best
countries could work towards
This was said by President Africa’s Mineral Development advanced technologies in mineral Practices Mineral Potential Index
building resilient economies,
Dr Mokgweetsi Masisi at the Programme, African Union’s prospecting and employing and clinched the first spot in the
promoting inclusive growth,
inaugural High Level Dialogue on African Mining Vision, and innovation and digitalisation to Investment Attractiveness Index,”
and ensuring that resource
Comparative Mineral Resources various SADC frameworks, maximise the value of its mineral he said.
wealth translated into tangible
Governance in Africa held in including the SADC Mining resources. He said such accolades
improvements in the well-being of
Gaborone yesterday. Protocol and the SADC Mining “By offering insights and underscored Botswana’s
their citizens.
He said Botswana was ready to Vision. lessons learned in these domains favourable mining policies,
President Masisi said Botswana
share in its relative success. “These interconnected Botswana seeks to contribute investment climate and mineral
had used its sizeable mineral
President Masisi said the programmes and visions, regional to the collective knowledge and potential, positioning the country
resources including, but not
country was a proponent of and international bodies are capacities of mining nations, as a leading destination for mining
limited to, diamonds, coal, copper,
multilateral, continental and working in harmony to promote fostering sustainable development, investment and development in
manganese, iron-ore, gold, and coal
regional frameworks and sustainable development, enhance responsible resource utilisation the region and globally.
bed methane towards development
institutions as they promulgated resource management and drive and value creation along the He highlighted that by
projects.
global, continental and regional economic growth across Africa. mineral value chain,” he said. embracing sustainable
“Botswana has re-invested its
development linkages. By aligning strategies, He added that through development practices and
mineral wealth in education and
“The United Nations Sustainable sharing best practices and collaboration and knowledge fostering a diversified economy,
health, in building robust road, rail
Development Goals, the African fostering collaboration, these sharing, countries could enhance Botswana aimed to navigate
and other infrastructure, in creating
Union’s Agenda 2063, and the initiatives aimed to address socio-economic outcomes, drive beyond the pitfalls of resting on
policies aimed at empowering
Southern African Development common challenges and leverage technological progress and past mining laurels towards a
Batswana and diversifying the
Community’s Regional Indicative opportunities for inclusive and achieve overall prosperity. more resilient and prosperous
economy, and in maintaining
Strategic Development Plan, sustainable development in the President Masisi said through its future. BOPA
an unparalleled commitment to
DailyNews Friday June 28, 2024 No. 120 Page 4

High poverty
levels worry
council
By Kehumile Moekejo through the new Ipelegeng Skills
Development component were
MABUTSANE - Mabutsane progressing well across the
District leadership has been district.
implored to develop strategies “The new Ipelegeng Skills
that will enhance creation of Development component projects
sustainable jobs and reduce in Mabutsane, Keng and Kokong
poverty among the communities. villages, being modification of
Addressing Mabutsane stage IV houses to semi-detached
District full council meeting LA1s are progressing satisfactorily, Mr Setammere-Ramosesane (left) and his deputy, Ms Nolly Dikgokgwane at the opening of the Mabutsane
on Tuesday, chairperson, Mr roofing and construction of septic District full council meeting on Tuesday. Mr Setammere-Ramosesane encouraged Mabutsane leadership to
Kgopolo Setammere-Ramosesane tanks has also commenced,” he ensure that programmes that would be implemented in the new financial years should focus on addressing
encouraged them to ensure said. BOPA the high poverty levels and unemployment rate in the district. Photo: Kehumile Moekejo
that programmes that would be
implemented in the new financial
years should focus on addressing
the high poverty levels and
Athlone Hospital undergoes refurbishment
unemployment rate in the district. By Jeremiah Sejabosigo client scope,” he said. minor challenges which we are Hospital refurbishment under
“The challenges are multi- He told councillors that Pro- liaising with the end user because DM model. Ms Dinoko expressed
faceted and the most prominent LOBATSE - Government is set Serve Consulting Botswana was the hospital is a live site, so we hope that would lead to quality
ones are high poverty levels and to undertake major refurbishment appointed by the Ministry of need to plan accordingly to ensure implementation of the project.
unemployment,” he said. of Athlone Hospital in Lobatse Transport and Public Works as that by the time we are ready to Tsopeng North councillor, Mr
He noted that the Quarterly aimed at addressing the hospital’s Development Manager (DM) break ground on site we have put Otlaabusa Keorapetse asked for
Multi Topic Survey conducted in dilapidated condition which has for the project and two other necessary measures in place to preservation of historical aspects
2021 showed that unemployment drawn complaints from the public major projects in the town, being allow them to move in order to of the hospital when carrying out
rate in Ngwaketse West, which for a long time. construction of Lobatse Leather allow us to continue our work,” he refurbishment works. BOPA
Mabutsane district was part of, In his address to a full council Park and construction of 53 staff said.
stood at 26.1 per cent with 24.7 per meeting on Tuesday, Lobatse houses for police officers. He pointed that their architects

No plans to
cent being youth. mayor, Mr Mosimanegape Dithebe Pro-Serve project manager Mr and engineers were conducting site
He also said the Botswana explained that the project would Victor Mokwape explained his assessment at Athlone Hospital.
Multi-Topic Household Survey of be implemented through the company would provide a turnkey Regarding the Lobatse Leather
2015 placed the district top on the Development Manager model of services from inception up to Park, Mr Mokwape said progress
poverty list at 40 per cent.
Subsequently, he said such
statistics called for effective
implementation of projects and
(DM) introduced by government
to accelerate delivery of quality
projects.
delivery of the three projects.
Concerning the Athlone Hospital
project, Mr Mokwape said they
of the project was at 7.5 per cent.
He said the project was slightly
delayed because it was in a Special
open BAMB
Mr Dithebe pointed that had already completed the pre- Economic Zone and involved a lot
programmes, with the main aim to
address major challenges.
Additionally, he said they
envisioned that the Social
the project scope entailed
refurbishment of existing facilities,
construction of a new theatre, new
feasibility study. He said they were
now on the concept and viability
stage, which entailed development
of stakeholders. He said they had
visited the site of the project and
needed to have discussions with
branch in
Seronga
staff houses, public toilets, and a of the plan in terms of how the various stakeholders involved in
Protection Services budget to be new accident and emergency unit. project would look like. the project and have clarity of the
depleted by August, owing to the “The inception report has been “Currently in terms of progress scope of works.
continuous increase of eligible approved and the project has we are sitting at 15 per cent. We “Currently we are preparing
beneficiaries. advanced to stage two (which is) are busy preparing what we call the stage one report or the inception
“To date, beneficiaries assisted concept and viability study. To date maximum guarantee price, which report,” he said. GABORONE - Assistant
are 2 805, which is 10 per cent of the architects in the project has evidently is the construction cost Maokaneng Ward councilor, Minister of Local Government and
the population in the district. mobilised personnel to the project or development cost for the project. Ms Tiny Dinoko was happy about Rural Development has told Ntlo
The numbers of beneficiaries for detailed design to meet the Currently we are experiencing just the move to include the Athlone Ya Dikgosi that there are no plans
continue to increase as compared to open a fully-fledged Botswana
to the last quarter which was 2 Agricultural Marketing Board
745. (BAMB) branch in Seronga.
We anticipate over expenditure Mr Setlhabelo Modukanele
under this vote during the current said this, on behalf of Minister of
financial year. Entrepreneurship, during the Ntlo
The projections show that the Ya Dikgosi meeting on Tuesday.
budget will be depleted by August He was responding to a question
this year,” he said. asked by Kgosi Disho Ndhowe of
On destitute and RADP housing the Okavango region on whether
projects, he noted that four out of the entrepreneurship ministry
10 destitute houses planned for the would consider opening a BAMB
last financial year were complete, branch at Seronga to cover
while six were currently at an catchment areas from Mogotho to
average of 75 per cent progress. Gudigwa in order to address the
He said 10 of the 14 RADP challenge of distance travelled
housing units were also complete, by farmers to access services at
leaving four ongoing and at an Shakawe.
average of 70 per cent physical However, Mr Modukanele said
status. in March, BAMB management
He said the project memorandum visited Seronga to assess how
for the 2024/2025 financial year the area could be assisted with
projects had been approved and bringing services closer to the
awaiting release of funds from the people.
ministry. “Effective July 1, BAMB
However, he noted that due to will make periodic deliveries to
budgetary constraints, the council Seronga based on the orders made.
would construct only two destitute This will either be coordinated
and three RADP housing units with the Seronga Kgotla or
during the current financial year. veterinary offices,” he said.
Furthermore, he told the council He added that such provision
meeting that a budget of P21 063 would be in line with the 2024/2025
074 had been allocated for the season Drought and Household
2024/2025 Ipelegeng programme, Food Security measures issued on
which he said would cater for June 20.
ISDC project, nine maintenance Similarly, he said arrangement
projects and 74 projects of semi- would be made with other
skilled labour. identified satellite areas in the
Mr Dithebe told a council meeting in Lobatse that government was set to undertake major refurbishment of
He assured councillors that country where there were no
Athlone Hospital aimed at addressing the hospital’s dilapidated condition.
modification projects undertaken BAMB branches. BOPA
 Friday June 28, 2024 No. 120 Page 5 DailyNews

As the general elections, slated for October draw nearer, different political parties are preparing for victory.

Political parties gear up for general elections

By Olekantse Sennamose contesting, the BCP has set itself a Kentse, said his party expects to “We were allocated seven Botswana Patriotic Front
target of 31 seats, enough to form conclude primary elections by the constituencies and we managed (BPF) information and publicity
GABORONE - As the general a government. end of June or first week of July. to reach consensus in six of them. secretary, Mr Amogelang
elections draw nearer, political Dr Pheko also welcomed the “That is the position of the party The only remaining constituency Mokwena indicated that his party
parties are preparing ground work move by Government to fund as was announced by President is Tati East. We tried by all means was supposed to hold its first
towards ‘victory’. In an interview political parties, but indicated Dr Mokgweetsi Masisi sometime to avoid primaries and prioritised batch of primary elections in this
with political party spokespersons, that the funds should have been back, and we are still awaiting consensus because primaries last weekend of June, while the
parties are confident that they will availed earlier than the stipulated further development following on have a risk of causing friction second batch was slated for the
emerge victorious. three months before elections, as that announcement,” he said. among those that have expressed first weekend of July.
For the Botswana Congress campaigns start much earlier. Mr Kentse also said so far his interest,” he said. “The first batch was for the north
Party (BCP) secretary general, The Botswana National Front party has not formulated any plans Mr Mashungwa said consensus of Dibete while the second batch
Dr Mpho Pheko, she said they (BNF) publicity secretary, Mr for candidates launch, but that the worked well for the BPP as the was for the south of the divide,
completed their primary elections Tumelo Legase, also said primary issue will be addressed soon. party was currently conflict free, but we have since postponed the
last year in November. elections by his party are all but “So far we have five which he said put the party in a primaries because we wanted to
“We have so far managed to done. constituencies where candidates good position to perform well in give our candidates enough time
identify candidates in all the “Under the Umbrella for are unopposed, and these are the general elections. to verify the voters’ rolls. This
54 constituencies out of the Democratic Change (UDC), Kanye North, Palapye, Boteti He said as one of the oldest is important to avoid any future
existing 61. We forfeited seven the BNF was allocated 26 West, Shashe West and Molepolole parties in the country, the BPP has complaints,” he said.
constituencies because we gauged constituencies and out of that, South,” he said. a duty to be exemplary for the sake Mr Mokwena said that they
our strength and noted that we do we are only left with Gaborone Concerning the Maun East of the larger opposition. will decide on the new date
not have that much of a chance in North and Lobatse owing constituency where the party has He said so far they have no after the verification process,
them,” she said. to some internal issues, and not yet identified a candidate, Mr plans on when they will start and that they do not expect the
Dr Pheko said, however, that primary elections for all the other Kentse said the party was still candidates’ launches as that was primaries to be a big deal as they
should a party member step up constituencies are done,” he said. seized with the matter, and that the responsibility of the larger will be held in just about seven
and stand for elections in one of He said after the completion of an announcement will be made as UDC. of the 34 constituencies they are
those, the party would offer them the remaining two, it is then that soon as consultations have been For his part, the Alliance for contesting in, while the rest have
full support. they can set dates for candidates’ concluded. Progressives (AP) spokesperson, compromised on one candidate.
She said completing primary launches, but he said they were Mr Kentse also said his party Dr Phenyo Butale, indicated “Remember that BPF is just
elections early has given her party thinking of the beginning of July was unfazed by the fact that its that his party was allocated 12 five years old, so we have not yet
enough time to gauge itself, and to October. candidates will be confirmed so constituencies and that they have established ourselves fully across
that they are currently on a roll-out On whether launching close to the general elections. “It is identified candidates in all of the country, and we had to forfeit
of launching candidates. candidates so close to the general our journey and we will be ready them, with candidates’ launces to some constituencies looking at
“The launches will culminate elections would not disadvantage when the general elections come,” start in July until a month or so our resources and strength on the
in that of the party president on them, Legase said candidates he said. before the general elections. ground,” he said.
a date that will be confirmed launch as just a part of a whole The Botswana People “We will publicise the dates, and He said that so far, party
with time, but I can assure the campaign exercise, and that Party (BPP) secretary of we have also finished primaries for structures have been ordered
electorate that the BCP is ready campaigns were already in full communications, Mr Alfred council wards and what is left is to hold political rallies to build
even if the national elections were force. Mashungwa, said his party has just completing ward allocations. up the hype, while candidates’
to be called tomorrow,” she said. The Botswana Democratic concluded primaries in all but We have been working with our launches were only expected after
She also said out of the 54 Party (BDP) chairman of one constituency they have been cooperating partners in the UDC,” the completion of the primaries.
constituencies that they will be communications, Mr Kagelelo allocated under the UDC. he said. BOPA.

It’s back!!!
 BUCKLE UP!
Seatbelts Are For Everyone

Friday June 28, 2024 No. 120

BMC official sensitises farmers

Goitsemodimo Williams- Lobatse we need at least 600 heads cattle at specified points within in the midst of the severe drought. money we use to buy stock feed
Madzonga per day while in Maun we require reach in their respective areas. “This year we have not received for the remaining cattle. This is a
120 which translates to 600 cattle He, however urged farmers to good rains and it is important to difficult year for both people and
ZOROGA - Beef producers have in a week but we only receive less work on improving the quality of sell some of our livestock to get animals,” he said. BOPA
been urged to feed and prepare than half in a week which therefore their cattle in order to get good
their cattle to meet the European
Union (EU) market standards.
Speaking at the Nata/Gweta
Block Beef Producers Field
means we are not reaching target
needed to export,” he said.
He decried that some cattle did
not the meet the EU standards and
returns on their investment.
Last year, he said a farmer who
sold about 20 cattle, got P30 750 for
one beast and also sold some at the
UB, GA forge partnership
Day recently, Procurement
Executive Manager at Botswana
Meat Commission (BMC) Mr
that led to BMC having surplus
of poor quality meat stockpiled at
their storages.
lowest price of about P20 000.
“This should be an inspiration
to other farmers for them to get
for sustainable gaming
industry
Kenneth Makubate said Botswana, He, therefore, urged farmers good returns for their investment,”
compared to neighbouring to take advantage of government he said.Mr Makubate was happy
countries also exporting beef to EU programmes such as Thuo Letlotlo that BMC continued to address
markets, paid the best price at a rate and subsidies to improve their challenges of late payments to
of P45 per kilogramme. breeds and upgrade quality of their farmers. By Marvin Motlhabane responsible manner, citing that
That, Mr Makubate said was livestock so that they could supply Earlier, Kgosi Modiro Thomas the collaboration aligned with
despite some challenges the BMC BMC with value meat. implored government to assist GABORONE - Embodied in their mandate. Mr Kesitilwe said
was faced with to get cattle of good He encouraged those wishing to farmers to find lucrative markets the launch of the ‘Motshameko he hoped the master’s students
quality meat required by the EU sell for local supply to take their for their cattle. O Phepa Scholarship’, Gambling would commence their studies in
protocols. cattle to Maun abattoirs where they He said local buyers, including Authority (GA) and the University the 2024/25 academic year, with
“Across all the operational BMC bought meat at P31 per kg. BMC, did not offer good profits for of Botswana (UB) signed an the expectation of completing their
abattoirs we experience shortage of He indicated that they assisted their cattle which they had worked agreement towards the sustainable programmes by 2026/27.
supply of cattle from farmers. In farmers with transport to collect hard to keep and feed, particularly development of the gambling As for PhD candidates, he
industry. said, they would also begin their
Through the partnership, academic journey in 2024/25,
six master’s students and four aiming to complete their research
doctoral students will be funded and dissertations by 2029/2030.
to pursue advanced studies under These timelines reflected
supervision of the UB faculties at commitment to providing
the university. comprehensive and rigorous
Delivering remarks at the academic training, ensuring that
signing ceremony in Gaborone scholars were well-prepared to
Monday, Gambling Authority tackle the challenges and seize
Chief Executive Officer, Mr Peter the opportunities that lie ahead, he
Kesitilwe, said the Motshameko O said.
Phepa Scholarship was more than a Meanwhile, UB Vice
financial grant and described it as Chancellor, Prof. David Norris,
an investment in the future of the said without doubt, UB had
gambling industry. contributed immensely towards
Mr Kesitilwe said by supporting human capital development in
10 individuals they were laying Botswana, however, one thing they
the foundation for innovative have not done well was creating
research, thought leadership, and new knowledge.
the development of a knowledge- Prof. Norris said new knowledge
based economy. was created through research and
He said the scholars would innovation, therefore, as part of
contribute significantly to the their transformation as a university
growth and development of they have placed research at the
Botswana’s gambling landscape, centre of what they want to be
adding that their mandate included doing going forward.
regulating and controlling the He said nowadays knowledge
gambling industry in Botswana was pivotal in powering economies
to ensure fair play, transparency, and as such they were eager to have
and protection of citizens from the outside world consume what
gambling-related harm. comes out of their research.
He said they were committed to Prof Norris said the relationship
promoting responsible gambling with Gambling Authority was
practices, preventing gambling pivotal in generating knowledge
Mr Makubate has urged beef producers to invest in their livestock to meet the European Union market
addiction, and ensuring that the that was instrumental in the
standards. industry operated in a socially gaming industry space. BOPA

Loose Inserts Back by popular demand.

U 1« ̜ Ìܜ à iiÌà ­«iÀ Ì œÕÃ>˜`®P635.00
U { ̜ n à iiÌà ­«iÀ Ì œÕÃ>˜`®P665.00
U ™ ̜ £Ó à iiÌà ­«iÀ Ì œÕÃ>˜`®P730.00
U £Î ̜ £È à iiÌà ­«iÀ Ì œÕÃ>˜`®P800.00
U ,>Ìià vœÀ >À}iÀ ˆ˜ÃiÀÌà >Û>ˆ>Li œ˜ ÀiµÕiÃÌ

œ˜Ì>VÌ\ 3653592, 3653620, 3653591,

3653587, 3653593, 3653599
 Friday June 28, 2024 No. 120 Page 7 DailyNews

PUBLIC NOTICE
NOTICE ISSUED IN COMPLIANCE WITH SECTION 10 OF THE ENVIRONMENTAL ASSESSMENT ACT (CAP 65:07)
NOTIFICATION FOR PUBLIC REVIEW OF THE ENVIRONMENTAL ASSESSMENT REPORT FOR THE PROPOSED WASTE WATER AND RECYCLING PROJECT AT CAMPHILL COMMUNITY TRUST, OTSE

7KHPDLQ¿QGLQJVRIDQ(QYLURQPHQWDO$VVHVVPHQW6WXG\IRUWKHDERYHSURMHFWDUHVXPPDUL]HGKHUHXQGHU
i.NATURE AND MAGNITUDE OF THE ACTIVITY
The proposed fully automated wastewater and recycling project to be implemented will comprise amongst others:
• 7KHWUHDWPHQWRIRXWÀRZVIURPH[LVWLQJVHSWLFWDQNVZLWKLQWKH&DPSKLOO&RPPXQLW\7UXVWSUHPLVHVWKDWZLOOEHSLSHGWRDFHQWUDOSODQW
• The installation of a 30m3EXIIHUWDQNZLWKEDIÀHVWRFRQWDLQWKHLQÀRZIURPWKHVHSWLFWDQN
• 7KHFRQVWUXFWLRQRIWZRKRUL]RQWDOÀRZJUDYHOUHHGEHGV
• Disinfection of the treated wastewater to ensure compliance with BOS 463:2011 Water Quality for Irrigation

7KHSXUSRVHRILPSOHPHQWLQJWKHSURMHFWLVWRXSJUDGHWKHKDQGOLQJRIGRPHVWLFZDVWHZDWHUZLWKLQWKHIDFLOLW\E\FROOHFWLQJDQGWUHDWLQJRXWÀRZVIURPH[LVWLQJVHSWLFWDQNVWKDWLVFXUUHQWO\GLVSRVHGRILQWRVRDNDZD\VRQVLWHWRD
FHQWUDOL]HGUHHGEHGEDVHGZDVWHZDWHUWUHDWPHQWSODQW7KHLQWHQGHGXSJUDGHLVDQHIIRUWWRLPSURYHZDVWHPDQDJHPHQWDQGUHXVHRIWKHWUHDWHGHIÀXHQWIRULUULJDWLRQSXUSRVHVZLWKLQWKH7UXVWSUHPLVHV
ii. LOCATION OF THE ACTIVITY
The proposed wastewater and recycling project is to be implemented within Camphill Community Trust premises. The Trust is located in Otse Village along the Old Gaborone – Lobatse Road. The treatment plant will be constructed
over an area measuring 50m x 50m.

iii. ANTICIPATED ENVIRONMENTAL IMPACTS AND PROPOSED MITIGATION MEASURES

The table below presents a summary of the Environmental Impacts and Mitigation/Enhancement measures.

Impact Mitigation/Enhancement Measures Impact Mitigation/Enhancement Measures

Dust nuisance • Adequate dust suppression measures including regular sprinkling of water Provision of temporary • Recruit as many local people as possible especially in the semi-skilled
especially on exposed surfaces within the premises over which trucks will employment and unskilled category.
travel should be undertaken. • Contracts of employment should be duly signed by newly employed
• Workers should be provided with appropriate dust masks especially during workers.
H[FDYDWLRQVEDFN¿OOLQJGXULQJSURMHFWLPSOHPHQWDWLRQWRSUHYHQWWKHP • The Contractor should adhere to labour laws.
from contracting respiratory diseases (or infections). • At least 50% of the work force should comprise of the youth and females.
• Excavation close to classrooms and residences along the sewer pipeline
route should be dust suppressed prior to and during works to minimise Boost to local /regional As much as possible and where feasible, the Contractor should procure
dust generation economy materials for the construction of the accommodation facility from local suppliers
placing emphasis on local participation.
Noise disturbance • Residents along the sewer pipeline route to the proposed wastewater
WUHDWPHQWSODQWVLWHVKRXOGEHQRWL¿HGDWOHDVWWZRGD\VEHIRUHWKH 5HGXFHGHI¿FLHQF\RI Strict adherence to the operation and maintenance plan for the facility to ensure
impending activities commence. wastewater treatment plant proper functioning of the system.
• Ensure that all stationary equipment is carefully oriented away from
sensitive receptors (classrooms, residences) along the sewer pipeline.
• Where possible, manual labour should be employed during excavation Creation of habitat for Regular maintenance of the wetland system should be undertaken.
DQGEDFN¿OOLQJDFWLYLWLHV wildlife
• No heavy machinery should be used when classes are in session.
Potential risk of reed plants • There should be regular monitoring of the perimeter of the wetland to
• Workers should be provided with adequate protective clothing including
invading surrounding areas ensure no signs of the reed species.
earplugs while on site.
• Use of chemical control to manage invasive reed species observed should
• All machines/equipment should be shut down during periods of inactivity.
be avoided. Mechanical means should be considered.
Land pollution due to • Housekeeping undertaken daily to maintain cleanliness on site • All equipment that will be used during the maintenance of the wetland
improper solid waste • Appropriate materials for construction procured. should be thoroughly cleaned before and after entering the site
handling • All waste should be categorized to encourage reuse and recycling.
Provision of clean air • Ensure that the wetland is functioning at its optimal levels.
• No waste should be burnt or buried on site.
• Ensure that the system is monitored regularly and any non-compliances’
• Adequate facility for the storage of materials should be created. Access to
noted should be addressed as soon as possible.
this facility should be controlled.
Generation of foul odour • There should be regular monthly checks carried out on the system
Risk of damage to buildings • There should be a pre and post construction photographic survey of
including the septic tanks, soakaways and sewer pipelines to ensure that
/structures abutting project structures along the sewer pipeline route.
there are no leaks or burst.
site • Repairs to damages observed should be undertaken after completion of
• There should be regular maintenance of the wetland including removal of
works.
GHDGOHDYHVSODQWVDQGHQVXULQJIUHHZDWHUÀRZLQWKHV\VWHP
Potential risk of soil • Portable spill containment and clean up equipment should be avaibale at
Reduced dependence on The enhancement of this system depends on the adherence to regular
contamination the contractor`s camp.
• All used oily rags and used oil canisters should be temporarily stored in borehole water for irigation scheduled maintenance of the system to generate the required amount of
used drums placed within a concrete bunded facility. HIÀXHQWWRLUULJDWHWKHIDUPV
• All fuel, lubricants and oils should be stored in clearly marked containers
Potential injuries to workers • )XOO\VWRFNHGDQGODEHOOHG¿UVWDLGER[VKRXOGEHUHDGLO\DYDLODEOHZLWKLQ
with lids. This should be placed on an impervious surface within a shaded
the camp. The box’s contents should be monitored and restocked.
bunded area within the perimeter of the camp.
• First aid incidents within the camp shall be logged,
• \Workers should be sensitised daily on prper handling of oils and fuels on
• Good housekeeping should be practiced ensuring minimal exposure to
site.
risk of OHS incidents and accidents occurring.
• All contaminated soil should be scooped and put in used drums for
• Ensure that information pertaining to site safety precautions is visibly
remediation by a licenced waste management company.
displayed at the entrance to the accommodation site for all to see and that
Risk of introduction and • Prior to moving equipment and trucks from one site to another, these the site itself has visible safety signage, as required.
spread of alien plant species should be power washed to prevent importation and exportation of plant • Provide the workers with adequate and appropriately sized PPEs and
materials and seeds. ensure regular monitoring to ensure they are worn when on site and
• Prior to ground-breaking at the site, the contractor should take note of all replaced on time when they are worn out.
plant species (trees and shrubs) existing within the project site.
Provision of temporary • Workers to be recruited should be from within Otse Village.
• If any specie is observed to be growing during construction, these should
employment • The Contractor should adhere to all requirements of the existing labour
immediately be removed manually.
laws.
• All vehicles should be inspected daily to ensure that they do not bring with
them any foreign plants on their wheels.
• Any weed on soil heaps should be removed regularly.

iv.CONCLUSION
The conclusion from the EA undertaken shows that there are both positive and negative impacts that may arise from the proposed project. The positive and negative impacts are as shown in the table above. The negative impacts are
PLWLJDEOHE\LPSOHPHQWLQJWKHPLWLJDWLRQPHDVXUHVUHFRPPHQGHG7KHSRVLWLYHLPSDFWVFDQEHHQKDQFHGWRPD[LPL]HWKHEHQH¿WVIURPWKHSURSRVHGSURMHFW
v.RECOMMENDATION
Following the undertaking of the EA Study, it is recommended that the project be allowed to proceed on condition that the recommended management measures are implemented and monitored as per Section 18 of the EA Act (CAP
65:07).
vi.ENVIRONMENTAL ASSESSMENT REPORT PLACEMENT (LOCATION) FOR PUBLIC REVIEW
Copies of the detailed Environmental Impact Statement have been placed at the following locations for review by the public.
1. Department of Environmental Protection Library (Gaborone),
2. Otse Tribal Administration (Kgotla),
vii.CORRESPONDENCES
Written comments or objections from those likely to be affected by the project and other interested people should be submitted to: The Director, Department of Environmental Protection, Private Bag 0068, Gaborone, Tel: 3902050, Fax:
3902051 or hand delivered to Travaglini House, Plot 1271, Second Floor, Old Lobatse Road by 30th July 2024.
The Director
Department of Environmental Protection
Private Bag 0068
Gaborone
Tel: (+267) 3902050, Fax: 3902051
 Dominating The
Stands Since 1962
www.kutlwano.gov.bw

Labotlhano Seetebosigo 28, 2024 Kgatiso 120

Tshwaragano e ka fenya borukutlhi

Ka Kefilwe Selotlegeng A re go ne go na le mephato e karolo ga morafe go botlhokwa, a goga kwa pele mo borukutlhing. Radisele a re motse wa gagwe o
e neng e itebagantse le ditiragalo tlhalosa gore ga gona ope yo ka O kopile banni go ema ka dinao, digoga kwa pele mo borukuthing.
RADISELE - Banni ba tsa mohuta o, mme go dirwa ka tlang go ba baakanyetsa seemo sa ba tla ka metlhale le maano a go A re ba tshwaragane le sepodisi
Radisele ba kopilwe go ikgata boithaopo. motse wa bone. lwantsha borukutlhi. go lwantsha borukuthi jo bo
motlhala go bona ka fa ba ka O tlhalositse fa tlhabologo O ba gakolotse go tlhama Kgosi Shathani Mmereki wa agileng mo motseng. BOPA
dirisang metllhale e e neng e e fetotse mekgwa e e neng dikomiti tsa twantsho borukuthi
dirisiwa bogologolo go lwantsha e dirisiwa go aga bana le go tsa ntebele-ke-go-lebele mo
borukutlhi le botlhoka tsebe jwa lwantsha borukuthi mo go neng motseng, kwa masimong le
banana. go dirwa ke magosi ka mephato meraka. O kgadile borre ba ba
Kopo e, e dirilwe ke Kgosi ya bone. kgokgontshang bomme le bana a
Prince Obuseng wa Lecheng Kgosi Obuseng a re go re borre ke basireletsi ba malwapa,
kwa thuto-puisanong ya twantsho botlhokwa gore botlhe ba tsaya ka jalo ba sa tshwanela go bonwa
borukuthi e e neng e tshwerwe karolo ba tsene mo dikomiting e le baba mo malwapeng.
kwa Radisele bosheng. tsa twantsho borukuthi go Mogolwane wa mapodisi a
Thuto-puisano e ne e ngokile tshwaraganela diemo tse. Palapye Supritendent Molly
maphata le makalana a a O rotloeditse morafe go Lebala-Moduke a re maikaelelo
ikemetseng mme gape ba na tseya boikarabelo jwa go bega a thuto-puisano ke go rotloetsa
le seabe mo dikgannyeng tsa borukuthi bope fela jo ba bo tshwaragano ya bone, morafe le
borukutlhi. bonang bo diragala maphata go lwantsha borukuthi.
Kgosi Obuseng yo eleng Kgosi o kgadile batsadi ba ba A re ba laleditse ba-na-le-
modulasetilo wa komiti-kgolo ya lobang kgokgontsho ya bana le go seabe go tla go ruta morafe ka
twantsho borukuthi ya kgaolo ya e rotloetsa ka go amogela dimpho tse di amang maphata a bone, le
sepodisi ya No2, a re tshwaragano tsa badira melato. go ba tlhalosetsa ka dikgang tsa
ya ba-na-le-seabe e ka hema A re tiriso botlhaswa mo go borukuthi.
borukuthi jo bo tsweletseng ka go tsa tlhakanelo dikobo ya bana ke Supritendent Moduke-Lebala Bangwe ba bana ba ba neng ba tsene dithuto tsa dipalo le
gola mo lefatsheng leno. molato, a tlholosa gore bana ba a re maikaelelo ke go nonotsha maranyane tse di neng di rulagantswe ke ba Destination
A re ntswa bogologolo go ne go felela ba senyegelwa ke bokamoso dikomiti tsa twantsho borukuthi Imagination Botswana mo Gaborone bosheng. Barulaganyi ba
sena mapodisi, mme borukuthi ka ba imisiwa ke borre ba ba tona gore di bereke. dithuto tseo, ba tlhalositse fa di diretswe go rotloetsa bo mankge
bo le teng, bo ne bo diragala ka mme ba sa tshwarwe. A re mo kgaolong ya gagwe ya ba kamoso mo go tsa boranyane le botlhami.
sewelo. Kgosi Obuseng a re go tsaya sepodisi motse wa Radisele o di Senepe: Tshoganetso Mokowe

REF. No: NLB 01/2024-25

ADVERTISEMENT OF UNSERVICED BUSINESS PLOTS AT KANYE, MOSHUPA,

PHITSHANE MOLOPO, MABUTSANE, MMATHETHE AND MAOKANE SUB
LAND BOARD AREAS IN THE NGWAKETSE TRIBAL AREA
ˆ 'MXM^IRW QENSVMX] S[RIH GMXM^IR GSQTERMIW ERH EJ½VQEXMZIEGXMSRTVSKVEQW ˆ 8IPIKVETLMG XIPIJE\ XIPITLSRI IQEMP WYFQMWWMSRW
TEVXRIVWLMTW EWWSGMEXMSRW  GSSTIVEXMZIW EVI ˆ %TTPMGERXW EVI EX PMFIVX] XS WYFQMX ETTPMGEXMSRW [MPPNOTFIEGGITXIH
MRZMXIH JSV XLI PIEWI SJ 119 YRWIVZMGIH FYWMRIWW JSV QSVI XLER SRI TPSX TVSZMHIH IEGL ETTPMGEXMSR
TPSXW FIMRK 'SQQIVGMEP 'MZMG  'SQQYRMX] ERH MW EGGSQTERMIH F] MXW S[R EHZIVX HSGYQIRXW ERH ˆ %TTPMGERXWWLEPPFIEVXLIGSWXWJSVXLITVITEVEXMSR
-RHYWXVMEP EX /ER]I 1SWLYTE 4LMXWLERI 1SPSTS TVSSJ SJ TE]QIRX LS[IZIV RS ETTPMGERX [MPP FI ERH WYFQMWWMSR SJ XLI ETTPMGEXMSR HSGYQIRXW
1QEXLIXLI 1EFYXWERI ERH 1ESOERI WYF PERH E[EVHIHQSVIXLERSRITPSXJVSQXLMWEHZIVX &] TYVGLEWMRK XLI EHZIVX ERH WYFQMXXMRK XLIMV
FSEVHEVIEWMRXLI2K[EOIXWI8VMFEP%VIE TVSTSWEPW ETTPMGERXW EVI VIRHIVMRK XLIQWIPZIW
ˆ 5YIVMIW VIPEXMRK XS XLMW EHZIVX QE] FI EHHVIWWIH FSYRHF]XLIXIVQWERHGSRHMXMSRWSJXLMWEHZIVX
ˆ 8LI (MWTSWMRK (ITEVXQIRX MW 2K[EOIXWI 0ERH MR [VMXMRK XS Land Board Secretary ,
&SEVH Ngwaketse Land Board , P/bag MK 11 ˆ 7SQI TPSXW LEZI FIIR VIWIVZIH JSV ZYPRIVEFPI
Kanye fax no: 5440343%XXIRXMSR 1V8LEXS KVSYTW FIMRK XLI 4ISTPI 0MZMRK ;MXL (MWEFMPMX]
ˆ 4SXIRXMEPMRZIWXSVWWLEPPMRSVHIVXSFIGSRWMHIVIH 0IFSXWI(tlebotse@gov.bw)361W 40;( =SYXLERH;SQIREWMRHMGEXIHMRXLIPMWX
JSVXLIE[EVHFIEFPIXSPIEWIXLITPSXWMREGGSVHERGI *1SROYXP[EXWM(fmonkutlwatsi@gov.bw)RSX SJTPSXW2SXIXLEXXLIWI[MPPFIEPPSGEXIHONLY
[MXLXLI0E[WSJ&SXW[EREERHGSRHMXMSRWSJPIEWI PEXIVXLERXL.YP] XS XLI KVSYTW MRHMGEXIH8LI VIQEMRMRK TPSXW [MPP
EKVIIQIRX FI GSQTIXIH JSV F] XLI KIRIVEP TYFPMG MRGPYHMRK
ˆ 3RISVMKMREPERHSRIMHIRXMGEPGST]SJXLIETTPMGEXMSR ZYPRIVEFPIKVSYTW
ˆ (SGYQIRXWQE]FIGSPPIGXIHJVSQ2K[EOIXWI0ERH HSGYQIRXWMREWIEPIHIRZIPSTIGPIEVP]QEVOIH “REF.
&SEVH ERH EX /ER]I 1SWLYTE 4LMXWLERI 1SPSTS No: NLB 01/2024-25 ADVERTISEMENT ˆ %J½VQEXMZI %GXMSR [MPP FI ETTPMIH JSV 2SR
1QEXLIXLI 1EFYXWERI ERH 1ESOERI 7YF 0ERH OF UNSERVICED BUSINESS PLOTS +SZIVRQIRXEP3VKERMWEXMSRW 2+3W 'SQQYRMX]
&SEVH 3J½GIW HYVMRK [SVOMRK LSYVW [MXL IJJIGX AT KANYE, MOSHUPA, PITSHANE &EWIH3VKERMWEXMSRW '&3´W XLEXEVIMRI\MWXIRGI
JVSQ03rd July 2024EJXIVTE]MRKERSRVIJYRHEFPI MOLOPO, MABUTSANE, MMATHETHE STIVEXMSREPERHFEWIHMRXLIEVIEETTPMIHJSV
JIISJ4 SRIXLSYWERHTYPESRP] TE]EFPIF] AND MAOKANE SUB LAND BOARD
GEWLSVGEVH AREAS IN THE NGWAKETSE TRIBAL ˆ 8LI(MWTSWMRK(ITEVXQIRX[MPPMRGSRWMHIVEXMSRSJ
AREA” WLEPP FI HIPMZIVIH XS 7YF 0ERH &SEVH XLIETTPMGEXMSRWI\IVGMWIXLITVMRGMTPISJIUYMXEFPI
ˆ =SYXLW ERH ]SYXL S[RIH GSQTERMIW TISTPI PMZMRK 7IGVIXEV]´W 3J½GIW MR XLI EFSZI REQIH 7YF 0ERH HMWXVMFYXMSR SJ PERH ERH ZMEFMPMX] SJ XLI TVSNIGX
[MXL HMWEFMPMXMIW (PLWD) ERH [SQIR [LS LEZI &SEVH3J½GIW36XS0ERH&SEVH7IGVIXEV]´W3J½GI TVSTSWEPW
FIRI½XIH JVSQ +SZIVRQIRX IQTS[IVQIRX RH *PSSV 3J½GI RS   2K[EOIXWI 0ERH &SEVH
EJ½VQEXMZI EGXMSR TVSKVEQW [MPP FI WSPH XLI 3J½GIW1TYYXWERI;EVH/ER]I ˆ %R] TIVWSR [LS TEVXMGMTEXIH MR XLI TVITEVEXMSRW
EHZIVXMWIQIRX HSGYQIRX EX   SJ XLI WIPPMRK GSQTMPEXMSRWSVER]TVSGIWW[LEXWSIZIVEWWSGMEXIH
TVMGI4VSSJSJIPMKMFMPMX][MPPFIXLVSYKLXLIYWISJ ˆ 3RIGST]QYWXFIGPIEVP]QEVOIH“ORIGINAL” [MXLXLMWHSGYQIRXSV[EWTVMZ]XSXLMWHSGYQIRX
2EXMSREP -HIRXMX] GEVH 3QERK  JSV ]SYXLW *SVQ ERHXLISXLIV“COPY” FIJSVI4YFPMG2SXMGIMWHMWUYEPM½IHJVSQFMHHMRK
JVSQ'-4%ERH-(WJSV]SYXLGSQTERMIW
HMWEFMPMX] GEVH JSV 40;( ERH 7YTTSVXMRK 0IXXIVW ˆ 8LI GPSWMRK XMQI JSV VIGIMTX SJ ETTPMGEXMSRW WLEPP
JVSQ VIPIZERX +SZIVRQIRX (ITEVXQIRXW JSV FI12:45 hoursSRXLI 02 August 20240EXI G.G. Moepeng
[SQIR [LS LEZI FIRI½XIH JVSQ +SZIVRQIRX WYFQMWWMSRWSJETTPMGEXMSRW[MPPNOTFIEGGITXIH LAND BOARD SECRETARY
 FRIDAY JUNE 28, 2024 | No. 120

1921-1980
DailyNews Friday June 28, 2024 No. 120 Page 10
Remembering SirBudget
SeretseSpeech
Khama

Sir Seretse: Modern day Moses

By Lindi Morwaeng equity. “I knew then that this was
not just a political decree, but
MOLEPOLOLE - As Botswana a momentous undertaking that
commemorates Sir Seretse would redefine the trajectory of
Khama Day, Ms Kgabonyana our nation,” she said.
Keitshwaretswe’s story provides Guided by Sir Seretse Khama’s
a unique and invaluable glimpse vision of a united, diverse
into the intricate workings of a Botswana, Ms Keitshwaretswe
critical chapter in the country’s set out on her mission to integrate
history. the Basarwa and Bakgalagadi
Ms Keitshwaretswe was communities. ‘We began by
not m e re ly a sp e c t ato r to building the foundations of
Botswana’s transformation under Loologane village, brick by
the stewardship of Sir Seretse brick. With every family that we
Khama, she was an active welcomed, we not only created
participant in the grand endeavor a place of residence but also
of building a nation that integrated a community that embraced
its diverse communities. Deep dif ference.’ E xpanding on
within the heart of Botswana her previous statement, Ms
lies a settlement known Keitshwaretswe revealed the
as Loologane, where the hidden meaning behind the
remarkable tale of its founder, Ms village’s name. “Loologane—it
Kgabonyana Keitshwaretswe, is derived from the Setswana
unfolds. At 78 years of age, Ms word ‘ologa,’ which means ‘to
Ms Keitshwaretswe said that Sir Seretse Khama had a unique approach to decision-making. He rescued the country
Keitshwaretswe’s life exemplifies come together’,” she explained
from the brink of hunger by securing food relief and aid from our allies.
the quiet yet extraordinary impact with pride. “The village’s name
of ordinary citizens on a nation’s represent s the c onc ept of
history. unity, of people from diverse vividly the potent lesson he
For Ms Keitshwaretswe, Sir backgrounds coming together in imparted upon the assembly.
Seretse Khama is not just a name one place to build a community “President Khama told a story
etched in history but a living that celebrates and strengthens to illustrate the importance of
memory, indelibly marked in the our differences.” due process and the rule of law,”
fabric of her life and the life of her Drawing from her recollection she explained. The story, as
country. “I met him personally in o f S i r S e r e t s e K h a m a’s told by President Khama at the
1962, during the early days of our words at the conference, Ms conference, told of a young boy
nation’s political awakening,” she Keitshwaretswe conveyed the who was responsible for herding
said with a faraway look in her late President’s vision with clarity his father’s cattle. His father
eyes, “His vision and charisma and poignancy. He said that “as warned him that if any of his
were extraordinary, laying the a nation that had been liberated cattle went astray, he would kill
groundwork for the country we from the shackles of colonialism, the boy. When one of the cattle
know today.” Botswana could not perpetuate went astray, his father called the
In 1979, against the backdrop the very divisions that had once boy to make an example of him,
of a young and developing oppressed us. To truly be free, he pretended to strike him with
Botswana, Ms Keitshwaretswe we must embrace all our people, an axe. Though his father never
found herself playing a vital regardless of their background or actually touched the boy, the fear
role in the country’s political circumstance.” The conference the boy felt was so great that he
evolution. It was at the of 1979, remembered by Ms died. “He taught us that it was
Botswana Democratic Party’s Keitshwaretswe as a significant not the master’s blow that killed
inaugural conference, held in milestone in Botswana’s political the boy, but the fear in his heart
the historic village of Serowe, history, not only marked the that proved fatal.”
that Sir Seretse Khama, the beginning of a national effort to Ms Keitshwaretswe said the
country’s first President, issued a foster inclusivity but also imparted story was a powerful reminder
that the law must be applied with from our allies. We began to husband and wife, each needing
momentous directive that would vital lessons in the tenets of see food items such as mealie the other,” she recalled, a hint of
set in motion a chain of events democracy. “As an organizing fairness and reason. “It showed
that if we reacted based solely meal, fish oil, eggs, and soup sadness in her voice.
shaping Botswana’s future. “At s e c r e t a r y f o r L e t l h a ke n g - that were previously unknown “The ruling party needed the
the conference, the late President Lephepe constituency I saw on emotion and anger, we would
be no better than those who had to us, all thanks to President voice of opposition, and now,
Khama charged me with the firsthand how the late former Khama’s diplomacy.” Her words that respectful balance has been
task of integrating marginalis president Khama stressed the oppressed us before.”
President Khama’s message captured the profound impact lost. We must remember the
ed communities, specifically the impor tance of democracy,” of Sir Seretse’s leadership in lessons of our history if we are
Basarwa and Bakgalagadi to she said. “He wanted us to was clear: “if Botswana were
to progress, we must embrace Botswana’s darkest hour. to move forward as a nation,” she
integrate them into mainstream understand that democracy is not The late Sir Seretse Khama’s said. Ms Keitshwaretswe’s vivid
society,” she recounted. just about voting, but about active justice and compassion in equal
measure.” Ms Keitshwaretswe’s ability to connect with people was, account of the grief that engulfed
These marginalised groups participation and engagement according to Ms Keitshwaretswe, Botswana following the passing
had been relegated to the fringes i n o u r n a t i o n’s a f f a i r s .” memories of the late President’s
approach to governance offered unparalleled. “He was beloved of Sir Seretse Khama on July 13,
of Botswana’s villages and towns, rds had not dimmed. by all ages because of his wit 1980, conveyed the magnitude
but with Sir Seretse Khama’s In that conference, the a glimpse into the man behind
the public figure. “Sir Seretse and humility. He had a way of of his impact on the nation.
vision of a united and prosperous l a t e P r e s i d e n t ’s w i s d o m speaking our language with such “It was as though the sun had
nation, the country embarked shone through once again. Khama had a unique approach
to decision-making,” she shared. elegance, yet remained down- stopped shining for a moment.
on a journey of inclusivity and Ms Keitshwaretswe recalled to-earth in his interactions,” she Even school children refused to
“He always said that ‘ntwa kgolo
ke ya molomo’ – essentially, that recalled. People would flock to attend classes,” she reminisced.
RAMATEA VOCATIONAL SCHOOL T/A RAVOS TECHNICAL COLLEGE: peace is more powerful than war. his kgotla meetings not just for “We were all inconsolable,
REGISTRATION IS ON FOR JUNE/JULY 2024 INTAKE CALL: 5403361/3 He emphasized the importance his insightful speeches, but also young and old alike. It was a
of dialogue and diplomacy over for his humor. He loved making difficult time for our country, but
t







(07&3/.&/5
410/4034)*1
*4
/08
"7"*-"#-&

people laugh, and they loved him also a testament to the love and
retaliation and confrontation.”
During the conference, when all the more for it. respect he commanded.”
)633:
41"$&4
"7"*-"#-&
"/%
"$$0..0%"5*0/
*4
"7"*-"#-&
063
$0634&4
%*1-0."
$0634&4
"3&
(07&3/.&/5410/403&% the suggestion of military action M s K g a b o n y a n a In Ms Keitshwaretswe’s eyes,
against Rhodesia was proposed Keitshwaretswe’s lamentations Sir Seretse Khama transcended





$FSUJöDBUF
JO
&BSMZ
$IJMEIPPE
&EVDBUJPO 
ZFBS in response to the Boer s’ over the current state of affairs the political realm, embodying





$FSUJöDBUF
JO
&BSMZ
$IJMEIPPE
UISPVHI
3FDPHOJUJPO
PG
1SJPS
-FBSOJOH
31-

NPOUIT transgressions at Lesoma, Sir in Botswana’s political landscape a higher purpose and inspiring





$FSUJöDBUF
JO
)FBMUI
BOE
4BGFUZ

ZFBS
Seretse Khama’s diplomatic were a poignant testimony of how a sense of reverence akin to





$FSUJöDBUF
JO
3FGSJHFSBUJPO
BOE
"JS
$POEJUJPOJOH

ZFBS





%JQMPNB
JO
&BSMZ
$IJMEIPPE
&EVDBUJPO

ZFBST approach was brought to light. far the country had, in her view, a biblical figure. “He was our





%JQMPNB
JO
0DDVQBUJPOBM
)FBMUI
BOE
4BGFUZ
1-64
&/7*30/.&/5

ZFBST Ms Keitshwaretswe reflected, strayed from Sir Seretse’s vision. Moses,” she declared with





%JQMPNB
JO
3FGSJHFSBUJPO
BOE
"JS
$POEJUJPOJOH

ZFBST



“Instead of responding with “Our politics have taken a wrong reverence. If we could have
violence, President Khama turn. There is no longer respect another man of his stature and
"--
"7"*-"#-&
0/
'6--5*.&
8&&,&/%
"/%
%*45"/$&
-&"3/*/(
advocated for dialogue and or decorum, even in Parliament. wisdom, I would die a contented
4)035
13"$5*$"-
$0634&4
negotiation with Rhodesia, We are embarrassing ourselves woman. He was a leader of
1. Hairdressing and Beauty Therapy (6 weeks) 2. Dressmaking & Fashion Design (6 weeks)
3. Welding And Fabrication (6 weeks) 4. Refrigeration and Air Conditioning (6 weeks) proving that his conviction in the in front of the world by using peace and vision, whose legacy
5. Livestock Production (6 weeks) 6. Small Stock Production and management power of diplomacy ran deep. unparliamentar y language,” will endure in our hearts and our
7. Solar Energy System Design, installation, and maintenance (6 weeks). Ms Keitshwaretswe shared a she lamented. The founding history for generations to come.”
8. Computer Applications (3 months) 8. Horticulture Management (6 weeks) poignant anecdote that painted principles of democracy that Ms rec eived Presidential
a picture of Sir Seretse Khama’s once anchored the country, Certificate of hour in recognition
/05&
"--
(075
410/403&%
456%&/54
(&5
&953"
'3&&
$0634&
*/
)"*3
%3&44*/(

#&"65:

5)&3"1:
03
-*7&450$,
130%6$5*0/
03
'"4)*0/
%&4*(/
03
4."--
450$,
.(.5
03

c ompas si onate leader ship according to Ms Keitshwaretswe, of long and faithful service to
)035*$6-563&
"/%
'3&&
-"1501 during the devastating drought of had seemingly eroded over Botswana bestowed upon her
1965. She said, “He rescued our time. “In the past, President by former President, Dr Seretse
)08
50
"11-:
Cell/WhatsApp 74132016 Or Visit us at Ga-Kgolo Ward, Kanye country from the brink of hunger Khama taught us that the ruling Khama Ian Khama on September
Email: ravostech@gmail.com or ravoscollege@gmail.com FaceBook @Ravos Technical College
by securing food relief and aid party and opposition were like 30, 2018. BOPA
 Friday June 28, 2024 No. 120 Page 11 DailyNews
Budget SpeechSir Seretse Khama
Remembering

First President: An astute envoy

By Baleseng Batlotleng accepted if they had ‘ulterior motives.’ as a key step towards decolonisation. after his visit to China.
Botswana had a unique voice on the In 1962 he founded the Bechuanaland “When we formed the BDF we were
G A B O RO N E - B ot sw a n a’s f i r s t international stage and it earned the Democratic Par ty (BDP). With its non-aligned and had good political ties
president, Sir Seretse Khama was nation a good global reputation. call for reform leading to a non-racial with the West and a political system
many things to many people. Fondly Speaking in an interview ahead of independent republic the BDP was able more like the West. When we formed
remembered for his quick wit, Sir Seretse Khama Day celebrations to draw overwhelming support. the military we approached all allies,
intelligence and great sense of humour on Monday, historian, Dr Jeff Ramsay It won the first universal franchise the West and Soviet two superpowers,”
that he employed to disarm anyone who said Sir Seretse’s banishment to Britain elections in March 1965, allowing said Dr Ramsay.
did not agree with him. set the tone for his subsequent foreign Sir Seretse to bec ome the f ir st According to Dr Ramsay the rigours
Sir Seretse could have chosen to live policy as he established a network of prime minister of a self-governing of constant travel for international
a quiet life at Maaloso-a-Ngwana kgotla people who would be important in the Bechuanaland Protectorate before full ne g ot iat i o ns, leading up to t h e
in Serowe where by right of birth he journey. “He gained experience about independence a year later. independence of Zimbabwe, finally
was accepted as the paramount chief international media and the political Five years after the formation of the exhausted Sir Seretse.
of Bangwato. connections that he forged throughout BDP, Sir Seretse outlined changes “ But he had the satisfaction of
It was the same impressive Britain and places like the United that had come with independence and witnessing both the independence
demeanour that he used to great effect States because of the circumstances broadly sketched Botswana’s growing of Zimbabwe in March 1980 and the
in his political life and which won him the of his banishment and the international relations with other states. launching of the Southern African
admiration of many across the globe. outrage,” he said, adding that he was He emphasised the need to work hard Development Coordination Conference
At independence, the founding an international figure and that it was a and subdue disruptive tribal differences (SADCC) in April before his death on
president had a dream for his country big controversy. if Botswana was to fulfil its promise in July 13, 1980, ” he said.
and it was first to establish a viable He added that during that time there both international and national spheres. During the entire period Sir Seretse
non-racial country and to secure the were a lot of Africans living in London It was an exhortation that would articulated a clear vision of the future
support of the international community, and that they would with time become be repeated over and over again as of Southern Africa after colonialism and
especially other African nations. leaders such as Dr Hastings Banda Botswana grew in stature and assumed apartheid, as a peaceful, democratic
It was not an easy task given the of Malawi and Mr Kwame Nkrumah of more significant roles in international and prosperous region, the same vision
geopolitical tension in the region at Ghana, noting that there was a sense affairs. as what has since become the Southern
the time and the steady rise in racial of Pan Africanism and liberation at the As Botswana progressed, Sir Seretse African Development Community
tensions and hostilities in southern time. was also able to turn more of his (SADC).
Africa during the 60s and 70s, but “Sir Seretse was quite aware of the attention to foreign policy, finding key Dr Ramsay also said Sir Seretse
Sir Seretse maintained non-racial situation in Rhodesia and South Africa early allies in presidents Dr Kenneth defined Botswana’s foreign policy in
policies at home and urged them on and was determined that Botswana Kaunda of Zambia and Dr Mwalimu terms of the principles of kagisano,
his neighbours. must remain separate. Unity was at the Julius Nyerere of Tanzania. In his final adding that his wise diplomatic policy
Then, Botswana was surrounded core of his vision and he pronounced decade he played an increasingly s aw B ot swa n a e nj oy i n g c o r di a l
by racist regimes of Rhodesia and that in 1958 at the Joint Advisory prominent role as a Pan African relations with countries whose political
apartheid South Africa. The geo-political meeting,” he added. statesman. philosophies were poles apart. These
environment of the day threatened Dr Ramsay said Sir Seretse was Sir Seretse’s first and vital task included the then Soviet Union, United
the very survival of Botswana as a a statesman who in word and deed in fo rei g n re lat i o ns was to w in States and the People’s Republic
sovereign nation, but the country did combined pragmatism with a genuinely understanding and respect from of China who were influential in the
not lose its unique voice on matters national vision. He said Sir Seretse’s fellow African states such as Zambia, establishment of the BDF.
of foreign policy. Sir Seretse chose to national vision was ar ticulated in Tanzania and Kenya. He said the suppor t Botswana
be vocal, sharing with the rest of the 1958 when, for the first time, he rose Many saw the exchange visits r e c e i ve d f r o m t h e i nte r nat i o n a l
world his ideals on how human beings to speak as a member of the Joint between Sir Seretse and Dr Kaunda in community made it difficult for South
ought to live together and manage their Advisory Council, noting that it was 1968 as a welcome confirmation of the Africa’s apartheid regime to attack
differences. several months after his return from latter’s understanding of Botswana’s the country as the minority white
Considering the adverse political enforced exile in the UK and three years international aims and posture. government would have loved to.
environment of the day, Sir Seretse before he began to form the Botswana Three years after independence, Sir He said Sir Seretse’s legacy could
could have easily chosen to remain Democratic Party (BDP). Seretse presented the international be summarised by the fact that in
silent and adopt a soft diplomatic He said the council was dominated community with a well formulated 1966 the reborn Botswana he led was
approach, but he decided to amplify by representatives of the white settler foreign policy based on principles he an impoverished and internationally
Botswana’s voice in the international community and dikgosi, and that at the had been enunciating at home. He obscure state, and that by the time of
arena. time most members had little interest was one of the “front-line presidents” his passing in 1980 the country was
He told the world that Botswana in democratic reforms and some who negotiated the future of Zimbabwe globally known as a staunch democratic
would not be deterred from speaking saw Botswana’s future as being best and Namibia. In the face of the terrorist and increasingly prosperous nation that
for what it believed was right by its served by joining the then white settler activities of the Ian Smith regime in was playing a positive and significant
precarious economic situation and the dominated Federation of the Rhodesias par ticular, the Botswana Defence role in regional affairs.
bold and brave approach earned Sir (Zambia & Zimbabwe) and Nyasaland Force (BDF) was established to guard Dr Ramsay said all these were
Seretse admiration locally and abroad. (Malawi). Botswana’s borders and to protect the indicative of Botswana’s positive role
He pointed out that Botswana From 1957 to 1962, Sir Seretse was growing number of refugees as well as and progressive diplomatic role under
would need external assistance for involved in the reform of local and the citizenry. Sir Seretse’s watch, a demeanour that
development because of its poverty, but territorial government leading to the Through his astuteness and shrewd must be replicated by future leaders.
declared that offers of aid would not be establishment of a Legislative Council diplomacy Sir Seretse established ties BOPA

BOTSWANA IS BORN: Queen’s Commissioner, Sir Hugh Norman- Walker (right), Kgosi Bathoen II (second right) Bechuanaland Prime Minister, Dr Seretse Khama (third right), Deputy Prime Minister,
Mr Ketumile Masire (fourth right) and the leader of Opposition, Mr Philip Matante at the opening of the historic Bechuanaland Independence Conference at Marlborough house on February 25, 1966 in
London. Upon arrival from London Dr Khama announced the complete success of their London talks. He informed Batswana that the Commonwealth Republic of Botswana would come into being on 30
September 1966.
DailyNews Friday June 28, 2024 No. 120 Page 12
Remembering SirBudget
SeretseSpeech
Khama
Sir Seretse
Khama and
wife Ruth
Botswana’s youth reflect on
Sir Seretse Khama’s legacy
By Taboka Ngwako and admiration, attributing their to contribute to society,” she said.
educational achievements and Nuku said currently, she was a
GABORONE - As the country career aspirations to Sir Seretse start-up support specialist, aiding
c ommemorates the lasting Khama’s policies. start-ups across Africa that are
legacy of its founding President, Youth innovator and founder funded by major organisations
Sir Seretse Khama, the impact of online application, Mr like the Bill & Melinda Gates
of his educ ational policies Martin Moatshe said currently, Foundation to grow, working for

Love beyond
resonates powerfully with the youngster’s like himself who Co-Creation Hub, the largest
youth. grew up in rural Botswana, technology innovation hub in
Revered for his visionar y benef itted directly from Sir Africa.
approach to education, Sir Seretse Khama’s educational “Additionally, I have ventured

the colour bar

Seretse Khama’s initiatives have policies. into entrepreneur ship with
left an indelible mark on the “I attended public primary and a social ser vices star tup
current generation, shaping their secondary schools, where the called ConvoLounge and this
aspirations and opportunities. emphasis on quality education venture connects youth, talent,
His administration came up enabled me to excel academically communities, and brands,
with Botswana’s first educational and I enjoyed free education up fostering conversations around
By Bonang Masolotate policy, called Education for to the University of Botswana opportunities in value chains
Kagisano (Social Harmony), level,” he said. to inspire career and business
GABORONE - One spring which guided the countr y’s He said this helped him to gain decisions for young people,”
evening, a young black prince educational development and the skills necessary to pursue a she said.
met a white young English administration from 1977 to career in the complex technology She highlighted that these
woman who would soon be a 1993. industry which is not only foreign opportunities, enabled by the
queen of an African tribe. Botswana under Sir Seretse to Botswana, but Africa as a country’s robust educational
That was in London in 1947 Khama through its two whole. system, have allowed her to
near Marble Arch, where the educational reform philosophies O n a broader impac t o n transition from being a student
late Sir Seretse Khama, heir of 1977 and 1994 envisioned a youth, Mr Moatshe indicated to a contributor in society.
to the Bangwato throne met a developing education system that the emphasis on education “ I h ave ac c e s s e d g l o b a l
clerk at Cuthbert Heath by the and the tribe, which was then that is on par with international has fostered a generation of oppor tunities and strive to
name Ms Ruth Williams. opposed to the marriage. standards. innovators and leaders who create more impact with my
“Seretse and I struck a chord Subsequent to his arrival, The education system was continue to uplift the nation. ideas, business ventures and
right from the beginning,” the the first kgotla meeting was developed to produce critical “Young people are now better skills and the selflessness of
late First Lady Ruth Khama somewhere around November thinkers, problem solvers, and equipped to compete globally, our forefathers, including Sir
expressed in a story file at the where Sir Seretse was formally innovative learners. pursue higher education, and Seretse Khama, who ensured
Botswana National Records charged for marrying without The system was designed engage in entrepreneur ial that our nation’s diamonds were
and Archives. The meeting, of the consent of the tribe and to provide opportunities for all activities because the foundation reinvested into our education
which she was invited by her secondly for marrying a white students by providing access laid was solid,” he noted. system, has greatly benefited my
sister, led to the two getting woman. According to Lady to all, improve the standards of M s Ya n d i N u k u s h a r e d journey,” she said.
along amid the disapproval Khama, the only solace from education, emancipate Batswana similar sentiments, reflecting Whilst Ms Naledi Mogomotsi
of her father. “In short, he the letter from her husband was from illiteracy, and develop their on the impact and legacy of “not her real names” highlighted
disapproved of my relationship that his grandfather, Khama the capabilities to create a social the educational opportunities in how Sir Seretse Khama’s vision
with Seretse,” Ms Khama stated Great, also married without the transformation in their lives. Botswana, she had experienced for education had personally
as she described how her father tribe’s consent. After several Education was to be a vehicle for first-hand the benefits of Sir shaped her life.
antagonised the relationship, meetings, the kgotla ultimately continuous positive change that Seretse Khama’s vision. “Thanks to the University of
and their affair would open agreed to accept the marriage, would ultimately enable people She said she was fortunate Botswana, I am pursuing a
them to an era of antagonism paving the way for the couple to to build a better world. to receive a sponsored degree degree in engineering, something
owing to the difference in their finally relocate to Serowe, the The youth, direct beneficiaries from government in Accounting my grandparents could only
skin colour and their quest for a capital of Bangwato, where Sir of his advanced policies, express and Finance from Botswana dream of,” she said.
marriage was not an easy one. Seretse would later leave for a diverse range of perspectives Accountancy College (BAC), She said the founding
“As soon as we had arranged Lobatse only to come back after on how his contributions have graduating in 2015 as one of the President ’s ef for ts to make
our wedding, definitely, Seretse the birth of their daughter. transformed their educational top 20 in her cohort. education accessible to
wrote to his uncle,” she stated. The couple then moved to journeys and inf luenced “Beyond tuition, I was also everyone, regardless of their
The uncle was none other than Lobatse and after six weeks B ot swa n a’s e d u c a t i o n a l provided an allowance for my background, had opened so
Kgosi Tshekedi Khama who government asked Sir Seretse landscape. living expenses and research, many doors for the youth and
was the Bangwato regent and to go back to London and he In an interview with BOPA, which significantly enhanced my she was proud to be a part of his
holding for him. refused. “After a few days later, several expressed gratitude problem-solving skills and ability legacy. BOPA
Not only was Kgosi Tshekedi however, we were both served
shocked and disapproved of with banishment orders,” said
the marriage arrangement, but Ms Khama as she described
he summoned him home with the family ordeal, adding that
immediate effect. Outraged by their only comfort in London
the planned marriage, Kgosi was reconciliation with her
Tshekedi lobbied the London family. The family was not only
Missionary Society to intervene exiled from their homeland,
to avert the intended marriage, but the apartheid regime of
but Sir Seretse Khama South Africa, which together
outsmarted him by bringing with Southern Rhodesia had
the marriage forward. dec lared them prohibited
However, due to the mounting immigrants, having expressed
pressure the vicar who had concern over the marriage and
agreed to conduct the marriage were among those not willing to
ceded and referred them to be associated with a Motswana
the Bishop of London who also chief married to a white woman.
refused to marry them due Desperate for their chief,
to political pressure. “I do not the tribe in September 1954
want to remember the rest of sent a direct let ter to the
the day. I had left Lewisham Queen, leading to the issue
expecting to be a married finding its way into the House
woman by the evening,” said of Commons although the
Ms K hama, detailing how government would not budge.
she was disappointed in her Eventually after six years and
wedding gown, having set two months, Sir Seretse was
during the ordination service allowed back home after he
only for the Bishop to tell them and his uncle renounced the
that the church would not be chieftainship for themselves.
involved without approval of the After about three weeks he was
government. joined by his wife and their two
In the midst of all the pressure, children back home where their
on September 29, 1948 the twins were born.
couple finally got married and At home, Sir Seretse entered
they were now husband and national politics and founded
wife. Three weeks after the the Botswana Democratic Party
marriage, Sir Seretse had to (BDP), which has won every
leave London for Serowe to elections since 1965. BOPA
face his much influential uncle Sir Seretse Khama at University of Botswana graduation ceremony
 Friday June 28, 2024 No. 120 Page 13 DailyNews
Budget SpeechSir Seretse Khama
Remembering

Sir Seretse Khama, the first President of Botswana, transformed the country from an impoverished state into a democratic
and increasingly prosperous nation with a significant role in Southern Africa. Born on July 1, 1921, in Serowe, Sir Seretse is
fondly remembered for his intelligence, integrity, and sense of humor. His lasting legacy is evident in the perpetual democracy,
socio-economic development, political stability, and unity that Batswana enjoy today, reflecting the values he stood for.

4
2 3
PIC 1. Sir Seretse Khama in a jovial mood after being from Nigerian High Commissioner, Mr Ignatius
sworn in as the first President of Botswana. Olisemeka in 1971.
PIC 2. Sir Seretse Khama (left) sharing a moment with PIC 5. University of Botswana, Lesotho and Swaziland
leader of opposition, Mr Philip Matante after the senior assistant registrar, Mr David Jenkins
opening of the second session of Parliament (centre) explaining the model of the Botswana
in 1968. University campus to Sir Seretse Khama
PIC 3. Sir Seretse (centre) and wife Ruth replacing (second left) in 1972.
South African Rands for Pulas during the PIC 6. Bakgatla leadership and tribesmen welcoming
introduction of the country’s new currency in Sir Seretse Khama during his visit to Mochudi
1976. At the time of launching the Pula, the in 1972. He was a staunch believer in consulting
denomination structure consisted of four notes with his people.
(P1, P2, P5 and P10) and four coins (1t, 5t, PIC 7. The body of Sir Seretse Khama arriving at
25t, and 50t). National Stadium for the nation to pay their last
PIC 4. President Khama receiving letters of credence respect to their President in July 1980.

6 7
DailyNews Friday June 28, 2024 No. 120 Page 14
Remembering SirBudget
SeretseSpeech
Khama

Profile of first
president
By Marvin Motlhabane “South Africa had come embroiled in warfare, racial
under the control of white enmity and corruption, Dr
GABORONE - Monday marks Afr ikaner nationalists in Ramsay said.
103 years since the birth of 19 4 8 . T h e t h e n L a b o u r He said the state’s mineral
Botswana’s first President, Sir Party government in Britain revenues were invested in
Seretse Khama. was desperate to secure its infrastructural development,
Fo l l o w i n g 81 ye a r s o f economic as well as political education and health, and in
economic underdevelopment ties with the new apartheid subsidies to cattle production.
and relative neglect, Sir regime. It therefore quietly The result was a great increase
Seretse Khama was elected agreed to bar Seretse Khama in general prosperity, in rural
to lead an impoverished and from chieftainship,” he said. as well as urban areas.
internationally obscure state. A judicial enquiry was set In addition, he said Sir
Historian, Dr Jeff Ramsay, up to try to prove Seretse’s Seretse Khama also used his
told BOPA that by the time of personal unfitness to rule, unique authority to enhance
Sir Seretse’s death, Botswana however, instead it concluded local democracy and curtail
had already become a that Seretse was eminently fit the powers of traditional
democratic and increasingly to rule, he said. chiefs, to develope citizen
prosperous nation that was Dr Ramsay said the administrative capacity without
playing a significant role in Commission’s repor t was over-bureaucratisation, and to
regional affairs. therefore suppressed by the promote the rule of law in the
Dr Ramsay said Sir Seretse British government, while operations of the state.
Khama was born on July 1, Seretse and his wife were As Botswana progressed,
1921 at Serowe in what was exiled to England, adding that Dr Ramsay said, Sir Seretse
then the Bangwato Tribal the persecution of Seretse Khama was also able to turn
Reserve of the Bechuanaland and Ruth Khama received more of his attention to foreign
Protectorate. extensive international press policy, finding key early allies
“He was the son and heir coverage and outrage was in Presidents Kenneth Kaunda
of Sekgoma K hama and expressed by a wide range of of Zambia and Julius Nyerere
Tebogo (nee Kebailele). In people around the world. of Tanzania.
1923 his father succeeded Eventually, in 1956, the In his final decade, he
his grandfather as the Kgosi British finally allowed Seretse played and inc reasingly
of the Bangwato. His reign, and Ruth to return to Botswana prominent role as a Pan
as Kgosi Sekgoma II was, as private citizens, he added. African statesman and
however, short lived as he Dr Ramsay said from 1957- became one of the “Front-Line
died in 1925. 62 Sir Seretse Khama was Presidents” who negotiated
With the death of his mother, involved in the reform of local the future of Zimbabwe and
in 1930, Sir Seretse remained and territorial government, Namibia, he said.
in the c are of his unc le leading to the establishment Dr Ramsay said in the face
Tshekedi Khama, who ruled of a Legislative Council as key of the terrorist activities of the
the Bangwato as regent,” he steps toward decolonisation Smith regime in particular,
said. and in 1962 he founded the the Botswana Defence
Sir Seretse received his Bechuanaland Democratic Force was created in 1977
higher primary and secondary Party (BDP). to guard Botswana’s borders,
education in South Africa With its call for reform leading protecting growing numbers
at two prominent mission to a non-racial independent of refugees as well as the
schools, Lovedale and Tiger republic, the BDP was able to citizens.
K l o of, b ef o r e e a r n i n g a draw overwhelming support, During this period Seretse
Bachelor of Arts degree at winning the first universal Khama articulated a clear
Fort Hare College, Dr Ramsay franchise elections in March vision of the future of Southern
said. 1965, allowing Seretse Khama Africa after colonialism and
Thereaf ter, he studied to become the first prime apar theid, as a peaceful,
law at t he Univer sit y of minister of a self-governing democratic and prosperous
Witwatersrand and Balloil Bechuanaland Protectorate region and was thus the key
College, Oxford, before taking before leading the country to founder of what has since
up further barrister studies at full independence a year later, become the Southern African
Inner Temple in London. he said. Development Community, he
In June 19 47, while in At independence, Botswana added.
London, Seretse first met was entirely surrounded by Dr Ramsay said the rigours of
Ruth W illiams, who was white racist regimes. It was, constant travel for international
then pursuing a career in therefore, widely but falsely negotiations, leading up to the
the financial sector, said Dr assumed that the country had independence of Zimbabwe,
Ramsay. no option but to sell-out to finally exhausted Seretse
He said their interracial its neighbours, South Africa Khama, but he had the final
marriage in September (including occupied South- satisfaction of witnessing
1948 ultimately threw the West Africa) and Southern both the independence of
British Empire into turmoil, Rhodesia. Zimbabwe in March 1980 and
adding that initially it was Dr Ramsay said the new the launching of the Southern
uncle, Tshekedi, who ordered g o v e r n m e n t , m o r e o v e r, African Development
Seretse home to demand a could not cover the costs of Coordination Conference in
divorce. administration from taxes, April, before his death on the
But, after a series of public and was continually indebted 13th July 1980.
meetings in Serowe, Seretse to Britain. The first task was Based on the latter, Dr
was popularly recognised as to lay the groundwork for an Ramsay said, Sir Seretse
Kgosi together with his wife. expor t-oriented economy, Khama is fondly remembered
Tshekedi then gave way and based on beef processing and for his intelligence, integrity,
went into self-exile. copper and diamond mining. and sense of humour.
Dr Ramsay said the Between 1966 and 1980 Of his lasting legacy it
pr o c lamat i o n of a blac k Botswana had the fastest can said that the perpetual
chief with a white wife, in a growing economy in the world democracy, socio-economic
territory strategically located and it also came to be seen development, political stability
between South Africa and a remarkable state with high and unit y that Batswana
the Rhodesias, caused principles, upholding liberal experience today are what
outcry among white settler democracy and non-racialism Sir Seretse Khama always
Seretse Khama politicians. in the middle of a region stood for. BOPA
 Friday June 28, 2024 No. 120 Page 15 DailyNews
Budget SpeechSir Seretse Khama
Remembering

Lefelo le le fa tlase ga ditlhare tsa matswere gaufi le letamo le go tla bong go tshwaretswe tiro ya mabelo
kwa Serowe. Rre Thomas Moseki yo eleng mogolo kwa Serowe a re lefelo le le na le ditso ka ke lone le
Sir Seretse Khama a neng a rata go tshwarela diphuthego teng a bapatsa phathi ya gagwe ya Botswana
Democratic party. A re go bapa le lefelo le ke letamo le Bangwato ba tswang goo-lowe ba nosa mo go
lone mme lone le agile ke mophato wa Masokola. Senepe: Kgotsofalang Botsang

Batswana ba gopola Seretse Khama

Ka Kgotsofalang Botsang Dinokwane a kaya.
“Re ne re le mmogo mo
SELEBI PHIKWE - E ne ya mophatong wa Malekantwa
tle e re banna ba lekgotla ba mme o ne a le mmotlana mo go
iketlile go buiwa ka ditlhabololo nna ka ngwaga,” Mme Keobake
tsa motse, ba bo ba ikaelana ka Kebonang yo o mo mophatong
dikgotla tse ba tswang kwa go le Sir Seretse a tlhalosa .
tsone tsa GaMmangwato. Mme Kebonang o tsetswe
Fa e kete go nna thata gore ba ka 1920 fa Sir Seretse e ne a
bangwe ba gakologelwe, motho tsetswe Phukwi a le malatsi a
a ikaye ka moraka o a ruetseng le masome mabedi le bongwe
kwa go o ne. ka 1921.
Se e ne e se poko, e ne e le Mma Odiegile jaaka ditsala
tlwaelo ka monna wa Mongwato tsa gagwe di mo ret a, ke
o ne a bonwa ka dikgomo ka mosadimogolo wa dingwaga
Bangwato ba tswa goo-lowe e tse di lekgolo le bone, mme a
le barua kgomo e bile ba dumela tsetswe kwa Serowe ka nako ya
gore ngwana wa mosimane fa motse wa Serowe o simolola,
o tshwanetse a tshwaelwe ka Bangwato ba thibelela kwa
bonana, gore a tsoge le e ne e Serowe go tswa kwa Palapye.
le rre yo o tlotlegang. O tlhalositse fa a le se a leng
Metsi e ne e le kgwetlho mme sone ka Kgosi ya gagwe ka e
Bangwato ba epa letamo le ba bile a ne a mo fa sediba kwa
tlaa nosang mo go lone, e le la Tswapong go nosa leruo la
morafe mme la nna bontlha jwa gagwe mme a santse a dirisa
ditso tse ba ipelang ka tsone mo sediba seo.
nakong ya gompieno. “Serowe yo o tlhabologile mo
Kgosi Keitse Mokamogo wa kgotlana ya Dinokwane kwa Serowe a tlhalosa ka botshelo ja gagwe le Sir Seretse Khama
“Letamo le re gola re le fitlhela, yo neng ele Tautona wa ntlha wa lefatshe leno ebile ele Kgosi ya Bangwato. Kgosi Mokamogo o supile fa Sir Seretse
matlhong ame, re simolotse re
le sa le le nna teng bogologolo Khama ene ele motho yo ratang batho ebile a le kutlwelobotlhoko. Senepe: Kgotsofalang Botsang nna mo matlong a Setswana
mme go supa fa le agilwe ke a ba a dir wa ditlhowa kwa
mophato. Mang le mang o ne a tsa phathi ya gagwe teng,” Rre Khulman yo e neng e le mongwe ka kakaretso a sena kgethololo, godimo mme mo nakong eno
nosa mo go lone,” Rre Thomas Alfred Thobolwane a tlatsa. wa mabutswapele a phathi ya Rre Thobolwane a supa. matlo a go nna jalo a nyeletse
Moseki a tlhalosa. Rre Thobolwane e ne e le kganetso ya Botswana National “Re ne re mo rata e re a tsile jaaka Serowe a tsweletse ka go
Rre Moseki o tsetswe ka 1937 mokgweetsi wa ga Sir Seretse Front. re mo amogela ka lorato, Kgosi tlhabologa,”Mme Kebonang a
kwa Serowe mme o supa fa go tswa ka ngwaga wa 1964 go Koloi ya gagwe ya mmala o Keitse Mokamogo wa kgotla ya supa. BOPA
letamo le, le nositse dikgomo tsa fitlhelela a tlhokafala ka 1980. lephutshe ya tla e gagasela
Bangwato ka lobaka ka le nele Lefelo le le bapile le kgotla e tlhomilwe tshipi e telele e
tshwara metsi a mantsi. ya Ditharapa, fa tlase ga tsela phaphasela folaga ya Foranta
“Ga go gake gore lebelo le le e fetang fa tlase ga sekole sa mme e re ba akabetse ba INTENTION TO CHANGE MARRIAGE PROPERTY REGIME
tla bong le tshwerwe e le la ntlha diatla sa Serowe. solofetse gore o tlaa ferekana
mo Serowe go ipelela letsatsi Pele ga ditlhopho tsa ntlha tsa maikutlo e bo e mo leba phuti (In terms of Section 8 (1) (f ) of the Married Persons Property Act, 2014)
la mogaka e bile e le tautona lefatshe leno, Sir Seretse o ne monyenyo e le o o kwa godimo 1. Baganne Boyboy Mabusa And Keaoleboga Bonang Mabusa (nee Mooketsi),
wa ntlha wa lefatshe leno Sir a tla mo lefelong le go bapatsa a ba a re “nnyaa mo leseng married in community of property on the 21st July 2006 at Serowe, wish to
Seretse Khama ka Matlhatso, le phathi e e ratiwa le ke ba change their property regime to “Out of community of property”
pathi ya gagwe mme go ne
bo le simolola gone fa letamong go suma, ngwana mogolo go kganetso tota.” 2. The parties intend to apply to the High Court of Botswana after the
le,” Rre Thomas Moseki a supa. tshwana fela, Bangwato ba tsile Le fa bontsi bo ne bo dumela expiration of the three (3) weeks statutory notice from the date of first
Letamo le o tlhalosa fa le na le ka dipalo tse di tsitsibanyang fa Kulman a tshwanetse go publication thereof.
ditso tsa Bangwato ka le epilwe mmele go tla go itseela ka tsebe otlhaelwa go tlhoka go tlotla
ke mophato wa Masokola e bile se se tswang mo ngwaneng wa kgosi, ba felela ba agela 3. Any person, creditor or debtor, who may have an interest in the assets
go bapa le lone go na le ditlhare bone e bile e le kgosi ya bone. mafoko a Kgosi mosako ya and/or liabilities of the parties’ estate, should they have objections to the
tse ditona tsa matswere tse “Sir Seretse e ne e le motho nna ditshego fela. parties changing their property regime, are to inform the parties before the
Sir Seretse a neng a buisetsa yo mamu, a rata batho le rona Sir Seretse jaaka expiration of the said 3 weeks period, or make representations before the
d i p h u t h e g o t s a p h a t h i ya re mo rata,” a tlhalosa. Bangwato ba ne ba mo reta, High Court of Botswana once the contemplated application is lodged.
Domkrag teng. Ka e ne e le motho yo dinyao, e ne e le motho yo neng a le
DATED AT MAUN THIS 17th DAY OF JUNE 2024
“Lefelo le ke motheo wa phathi ya re nako nngwe a ntse a buisa kutlwelobotlhoko, a rata batho
_________________
ya Domkrag mo Serowe, ke diphuthego gone fa ditlhareng e re a tsile mo Serowe a bo a Baganne Boyboy Mabusa
gone kwa rraarona a neng a tsa matswere gaufi le letamo tsamaya mo motseng a lekola P O Box 30214 Serowe
rata go tshwara diphuthego la morafe, ga goroga Rre Todd masika a gagwe le Bangwato Contacts: 74068993
DailyNews Friday June 28, 2024 No. 120 Page 16
Remembering SirBudget
SeretseSpeech
Khama

Sir Seretse Khama and Sir Ketumile Masire Botswana flag

Sir Seretse
Khama
statesman par
The Union Jack being brought down in
September 30, 1966
excellence
By Pako Lebanna ideas and kept the government in check,” Dr Ramsay says.
Dr Ramsay reveals. In terms of regional geopolitic s,
GABORONE - As the clock struck It was crucial that while the opposition Botswana gained independence
midnight on September 30, 1966, and as BNF and BPP held socialist and Pan surrounded almost wholly by hostile
Batswana braved a strong, gushing wind Africanist ideological leanings respectively, white minority ruled states, apartheid
that engulfed the National Stadium when and the governing BDP was market South Africa and South West Africa
the Union Jack was lowered to make way oriented, these main independence-era (Namibia) and Rhodesia (Zimbabwe), with
to the new blue, black and white national political formations all believed in a unitary Botswana’s border with Zambia, the small
flag, the excitement of independence that democratic republican state, Dr Ramsay stretch of land at the confluence of the
reverberated belied a real concern of how observes. “After years of districts or Chobe and Zambezi rivers at Kazungula,
viable the Republic of Botswana would be. reserves being governed by powerful Botswana’s only link to independent
Two days earlier, journalist Charles paramount chiefs, the political parties had Black Africa. In assigning Prof Zachariah
King, writing for the Southern African enjoyed electoral majority in general a common belief in a unitary republican “ZK” Matthews, a widely respected Pan
News Ser vice, published an ar ticle elections; a revered figure from the state and parliamentary democracy. Africanist academic, a South African with
on September 28, 1966, stating the Bangwato royal family, having built his own Also, while BDP largely spoke of the roots in Botswana, the task of Botswana’s
hopelessness that seemed to underpin personal reputation when his ‘Marriage of market economy, for practical reasons, first Permanent Ambassador to the United
the fortunes of this new nation state. Convenience’ to Ruth Williams made a developmental state evolved. The Nations at New York, Sir Seretse laid the
K ing w r ote, “ B ec huanaland: A n global news in the 1950s, Sir Seretse’s economy was open to private investment tone for Botswana’s seamless integration
impoverished, arid and hungry land choices were instrumental early on. and small businesses thrived, but the state into the global diplomatic system.
without hope of achieving economic “During those early years, Sir Seretse’s intervened for social good, through the “Prof. ZK Matthews had been a mentor
stability makes its debut this week influence was huge, he had great clout. National Development Plans (NDPs) and to many of Africa’s independence-era
among the community of nations. The Also, it was common practice in the state-led companies like the Botswana leaders from East and Southern Africa.
new blue, white and black flags are flying African continent for the ‘big men’ political Meat Commission (BMC),” Dr Ramsay Botswana had been considered a weak
everywhere in Gaborone, its incongruous leaders to have the leeway to give their notes. state that some thought would even
capital city.” He added, “Elsewhere in the new states whatever direction they sought. This included the state also taking control collaborate with her powerful neighbours,
vast, trackless wasteland that will take If Sir Seretse wanted Botswana to be of the mineral resources for the benefit of apartheid South Africa and Rhodesia, but
the name of Botswana, there is little to a one party state, or for proceeds from the country as a whole, he relates. “The Sir Seretse communicated a clear desire
celebrate. Two years of disastrous drought mineral wealth to be concentrated in decision just after independence for all for a non-racial, democratic Southern
and crop failure have brought havoc and one part of the country, that could have tribal territories to cede mineral rights Africa,” Dr Ramsay states.
hunger to its widely scattered agricultural happened with less resistance than later to the state, which would then negotiate Working with Dr Kenneth Kaunda of
inhabitants. More than one fifth of the years,” Dr Ramsay says. with mining companies on behalf of the Zambia and Julius Nyerere of Tanzania,
population is literally being kept alive by Instead, he chose to pursue the nation, was instrumental. This ensured Sir Seretse was part of the troika that
emergency feeding and the numbers are multiparty democratic system, which had if a mineral deposit was discovered in founded the Frontline States group that
rapidly increasing.” been unpopular in the early years of post- a tribal territory or private property, the agitated for the liberation of Southern
Nigh on six decades later, owing in independence Africa, but later proved to resource would be of benefit to the nation African states and got actively involved
part to the visionary leadership and have been a wise move; and the country as a whole,” reminisces Dr Ramsay. in negotiations for the independence of
pioneering groundwork of Botswana’s followed prudent macroeconomic policies, The introduction of the land boards also Rhodesia as Zimbabwe; and the formation
founding President, Sir Seretse Khama, underpinned by fiscal restraint and usurped the powers over land ownership of what is now the Southern African
Botswana has evolved from one of the prioritising key developmental projects and distribution from the tribal leaders Development Community (SADC), which
world’s poorest, least developed states at across the country. to the state, in order to ensure more both occurred in April 1980.
independence towards the current middle “ Under Sir Seretse’s leadership, equitable distribution of land. Three months later, July 13, 1980, the
income status; and stayed Africa’s oldest, Botswana allowed freedom of association Yet , f o r t h e p o s t - i n d e p e n d e n c e nation woke up to the news relayed on
continuous multiparty democracy. and democratic politics underpinned by government, shortage of skilled manpower, Radio Botswana by Vice President Quett
“The contribution of Sir Seretse Khama Tswana culture, the Kgotla system, the was a challenge, with eight decades of Ketumile Masire that President Sir Seretse
towards this transformation has been ‘Kagisano’ value of nation building, and British colonial rule having not yielded an Goitsebeng Khama had died of pancreatic
immense,” historian Dr Jeff Ramsey tells ‘Therisanyo’ national consultation and educated and trained workforce. cancer. The Daily News front page carried
BOPA in a wide ranging interview. “First, consensus building,” Dr Ramsay says. The new government had to navigate the headlines “The Nation Mourns Sir
let us stress that Sir Seretse was never “Although BDP had an overwhelming the path of retaining expatriate workers Seretse Khama” and “Sechaba Se Mo
alone in laying the foundation for the nation m a j o r i t y, e v e r y P a r l i a m e n t f r o m to run government and ensure skills Khutshafalong.”
that Botswana would be. His leadership independence had a political opposition, transfer to locals, who were steadily being Aged 59, Sir Seretse had done his
was always in partnership with his deputy, led by robust characters like Mr Philip offered training. “The likes of Police work as a national lodestar, leaving
Sir Ketumile Masire, who played and Matante of the Botswana People’s Commissioner Simon Hirschfelt and behind his legacy as a statesman par
oversized role as Vice President, Minister Party (BPP), Mr Motsamai Mpho of the founding Commander of the Botswana excellence who laid a solid foundation
of Finance and Development Planning.” Botswana Independence Party (BIP) Defence Force (BDF) Lt. Gen. Mompati for the Botswana post-independence
But, as a powerful political leader during as well as Dr Kenneth Koma and Kgosi Merafhe gradually took over. It was miracle, an anticipated failed state’s
the 1960s and 1970s, whose governing Bathoen Gaseitsewe from the Botswana important to identify which people could metamorphosis into an African success
Botswana Democratic Par ty (BDP) National Front (BNF). They had their own deliver, in cabinet and the civil service,” story. BOPA
 Friday June 28, 2024 No. 120 Page 17 DailyNews

KITSISO SETŠHABA
KAGO YA TSELA E E GOKAGANYANG METSE YA GOODHOPE-KGORO LE GATHWANE
Responsible Setshaba se itsesiwe fa kompone ya Steelbase (Pty) Ltd e abetswe tiro ya tsela ka ha tlase ga tumalano ya “Output and Performance Based
Road Contract for Completion of: Package 2 – LOT 1 Road Section Rakhuna Junction – Mabule Road Main Road (145.45km) and Access Roads (29.03km)
Contract Number Tender No: MTPW/POU/DOR/WOR/06/2022-2023” bontlhabongwe jwa tiro e bo akaretsa go aga tsela e e gokaganyang metse ya
Goodhope, Kgoro le Gathwane.

Tiro e ya go aga tsele e patilwe ke dipatlisiso tse di tshwanetseng go ka dirwa pele ha kago e ka simologa. Dipatlisiso tse di akaretsa go tlhodumela
boleng jwa matlo le dikago tse di bapileng le moalo wa tsela le go batla bao ba tsela e amileng ditsha ba bone. Ka jalo, kompone ya Steelbase (Pty) Ltd e
tlamega go itsise bao ba ba amegang ebile ba na le dikgatlhego mo kagong ya tsela e. Mo go direng seo, kompone e tlaa tshwara diphuthego tsa kgotla
mo mafelong a a latelang.

Motse Lefelo la bokopano Letsatsi Nako

Gathwane Gathwane Kgotla Kgwedi ya Phukwi e tlhola malatsi a le mararo. Borobabongwe mo mosong

Kgoro Kgoro Kgotla Kgwedi ya Phukwi e tlhola malatsi a le mane. Borobabongwe mo mosong

Ba ba nang le dipotso kana megopolo mabapi le phuthego e ba ka ikgolaganya le kompone ba dirisa metlhale e e latelang;

P O. Box 1009, Gaborone

SHE Officer: Oscar Khudu: (+267) 75 294 883 oscarkhudu@gmail.com
CLO: Senwane Lore: (+267) 76 098 528 signahlor@gmail.com

Kgotsa ba isa makwalo/ go bua le ba kompone ka senamang ko diphaposing tsa kompone ko motseng wa Kgoro.

PUBLIC NOTICE
CONSTRUCTION OF GOODHOPE-KGORO-GATHWANE ACCESS ROAD AND ASSOCIATED WORKS
The public is informed that Steelbase (Pty) Ltd has been awarded an Output and Performance Based Road Contract for Completion of: Package 2 – LOT
1 Road Section Rakhuna Junction – Mabule Road Main Road (145.45km) and Access Roads (29.03km) Contract Number Tender No: MTPW/POU/DOR/
WOR/06/2022-2023. Part of the project works include construction of Goodhope-Kgoro-Gathwane access road and associated works.

As part of road construction, expropriation and condition survey must be undertaken prior to commencement of the earth works which calls for interested
and affected parties to be informed of the activity. It is on this basis that the company propose to conduct kgotla meetings to inform the community
about condition survey and land expropriation activities on the following dates and locations.

Location Venue Date Time

Gathwane Gathwane Kgotla 3rd July 2024 0900am

Kgoro Kgoro Kgotla 4th July 2024 0900am

Any comments or enquiries regarding the proposed meetings may be sent to the following address and contact persons’ bellows;

P O. Box 1009, Gaborone

SHE Officer: Oscar Khudu: (+267) 75 294 883 oscarkhudu@gmail.com
CLO: Senwane Lore: (+267) 76 098 528 signahlor@gmail.com

Or hand delivered/ reported in person to Steelbase (Pty) Ltd Kgoro Campsite office
DailyNews Friday June 28, 2024 No. 120 Page 18

ClassifiedAds
3 HERD BOYS wanted. Joshua Lewanika KE BATA MODISA ele motho wa mme MONTY MAIKANO WISHES to
Box 1196 Tonota 71671864 a disa dipodi ko Mafungo/Hubona. change land use from commercial
FARM WORKER WANTED at Dimawe. Thomas Babili 77852535 Box 20308 to camp-site. Anyone with
Be able to read and write English and Monarch objection must contact Tutume
Setswana. Box 502823 Gaborone. FARM WORKER WANTED at Mmutle District council, Physical Planning
BUSINESS LOANS APPLICATION, TWO HERDMEN WANTED at Diphephe farms in Kweneng District, write to office.
AUTOMOTIVES Cashflows 73 343 501. lands P O Box 41087 Gaborone. Call P.O Box 595 Molepolole or contact
71720570 / 72191136. Closing date : July OWNER OF PLOT no. 7516,Ga Sau
76784611 K. Mashabane. ward,Moshupa would like to inform
2, 2024.
FARM WORKER WANTED, Maboane. neighbours about intentions to
SEEKING OWNERS OF B850ATC
Volkswagen Caravelle owned by FARM WORKERS Contact: S. Selotlegeng, 75921234. P O FARM WORKER WANTED in build a boundary wall.Any objection
BOX 5497 Gaborone Mokoloboto farm-Sefhare (2). Job should be forwarded to Moshupa
TUMCHI CONSULTANCY(PTY) LTD in description : working in the farm with 8
respect of legal change of ownership. HERD BOY WANTED urgently at 2 WANTED FARM workers at Tibitswane district council,physical planning
Mopipi. Call 75249574. P. O. BOX 118, years experience ,growing vegetables. office at telephone no.5449950 within
Contact: 2470112 or email sarah. Farms, Dikeledi Koketso, P O Box AE 847
Mopipi Qualification : PSLE or equivalent. fourteen(14) days of this publication of
gibbonsgdc@gmail.com AEH Gaborone.
Contact : Elizabeth Gobotswang, this notice.
2 FARM WORKERS wanted at CALOS FARM WORKERS WANTED: 76026391, P.O Box 2513, Mahalapye.
CAROTO PTY LTD T/A CATERBOT
BUSINESS SERVICES INVESTMENT farm PO-8 Nata Box 2753
Mokgachawa Ditshepe lands.Apply to:
Balathile Dialwa P.O.Box 50 Palapye
Closing date 24/07/24 REUBEN MOLEFHE, OWNER of plot
787 Lenganeng Tlokweng, wishes to
F/town Carlos Andries Caroto 76882492 change land use from Single-Family
TENDER PREPARATION, SECURITY, FARM MANAGER WANTED URGENTLY LOOKING FOR Farm NEIGHBOUR CONSULTATION residence to Civic and Community (Day
Cleaning, IT, Construction, Compliance. Mologwana lands. P. O. BOX 858 Workers X2. Apply to Khabetshana care and Preschool). For any objections,
74402828 Gaborone or cell 71 313 898 via Emily Phale, Box 1503 Mogoditshane TOPO MOGOLODI ONKEMETSE contact Tlokweng District Council,
A I R - C O N D I T I O N I N G , whatsapp HERDBOY FOR CATTLE and goats in wish to change land use from Physical Planning Office, Telephone No.
REFRIGERATION, Refridgerated Dutlwe 2 years experience no drinking agriculture to mixed use (agriculture 3696000 within fourteen (14) days of
Trucks, coldrooms 76 640 740. FARM WORKER WANTED at publication of this notice.
no smoking 72100673/ 73212004 & commercial) at Dukwi. Anyone
Nshakashogwe. Mr Alec Tabona
BOREHOLE DRILLING AT low rates 76 LOOKING FOR A Seasoal Farm Worker with objection must contact the I MPHO TEFO Ntshole owner of plot
77708928 Box 52 Nshakashogwe
274 598 / 76 834 659 at Hebron. Box 2958 Gaborone, Tel: Tutume District Council Physical in Phatlhaneng/Matebeleng wishes
LOOKING FOR A FARM worker 73836952 Planning office. to inform neighbours about intent to
DESIGN & BUILD SPECIALISTS for ,Mmatshumo P.O. Box 1279 Orapa. change land use from horticulture to
standard, Premium Carports 78 553 920. NEED A FARM worker at Mmatshwene multiresidential.For further enquiries
Keitumetse Modori 71988239 CHANGE OF LANDUSE. Owner of plot
lands in Kgatleng district to take care contact Kgatleng district council
920 in Gaborone Extension 2 would
of smallstock,chicken, ploughing field physical planning at:5777411/5773512
NOTICE OF INTENTION TO DISPOSE TRIBAL LAND TO NON-CITIZEN and general upkeep of the yard.Salary
like to change use from residential to
commercial. Any objections to this or me 72767519 within 14 days of
NOTICE IS HEREBY GIVEN in terms of Sections 34 of the Tribal Land Act of 2018, that Dithong P1500.00Call Tiny Ralefala on 71990262 publication.
proposal should be lodged within
Lebogang Moatswi hereby gives notice of intention to Cede and transfer the under-mentioned LONG TERM FARM worker heading 14 days from the publication date of
property to More Bliss Proprietary Limited herein represented by Brain Marimo. cattle in Hebron. Box 2958 Gaborone. CHANGE OF LANDUSE Owner of plot
this notice and all enquiries contact
Cell 73836952. 923 and 924 Gaborone Extension 2
CERTAIN : Residential Plot Gaborone city council at 3657537.
would like to consolidate and change
SITUATE : in Sexaxa Layout in the Batawana Tribal Administration
NOTICE OF NEXT OF KIN MEETINGS use from residential to commercial.
MEASURING : 20m + 40m + 15m + 7.07m + 35m
Administration of Estates Act Any objections to this proposal should
WHICH PROPERTY : held under a Board resolution letter issued by Maun Sub Land Board
be lodged within 14 days from the
Dated 5th May 2022. [Cap.31:01] publication date of this notice and
The transaction is valued at P40.000.00 (forty thousand pula only). By virtue of this notice, any NOTICE IS HEREBY given that by virtue of section 31 of the Administration of Estates Act (Cap:33:01), heirs all enquiries contact Gaborone City
citizen willing and able to likewise conclude such transaction may make a similar offer through and next of kin of the deceased and all persons having claims against the above estate, are being called upon Council at 3657537.
to attend before the Master of the High Court at Francistown High Court on the dates and times specified
to Kemofilwe Nkgaswa P O Box 20332 Boseja,Maun within thirty (30) days of this advert. opposite the names of their deceased relatives for purposes of recommending for appointment, a person or
Kemofilwe Nkgaswa Cell: 76 463 908. persons as Executor/Executrix Dative as well as identifying beneficiaries and to discuss any other business
relating to their deceased relative. TUITION
Name of Deceased Person Estate Number Date of Meeting Time Master
APPLICATION FOR A CERTIFIED COPY OF TITLE DEED RATA TUTORIALS FOR Primary and
D DAVID KANKANGWANE KABELO ESHFT-000018-24 03/09/2024 1100HRS BASUPI
NOTICE IS HEREBY GIVEN THAT the undersigned intends to apply for a certified copy of title deed No; FTTL AND CHEDU KABELO Secondary, Serowe 71800595/71502365
413/2009 DATED 19 AUGUST 2009 made in favour of NOBO BOTIPENG. DATED AT FRANCISTOWN THIS 17TH DAY OF JUNE 2024
In respect of; ________________________________
CERTAIN : Piece of land being Tribal Lot 8852 Serowe MASTER OF THE HIGH COURT
SITUATED : at Serowe in the Bangwato Tribal Territory
MEASURING : 125.2628 Ha (one hundred and twenty five point two six two eight)
VACANCIES
AS WILL MORE NOTICE TO DEBTORS AND CREDITORS
FULLY APPEAR: From the diagram DSM No 1173/2009 surveyed by Land surveyor W. M. Ratsie in April 2009 Master’s Reference: ESHGB-000214-23 LOOKING FOR STRUCTURAL engineer,
and approved by the Director of Surveys and Mapping on the 24 day of June 2009.
All persons having objections to the issue of such copy are hereby required to lodge the same with the Registrar
10 years experience. akalikobotswana@
IN THE ESTATE of the Late FILDA GOMBAKOMBA who died at Nkoyaphiri Plot No.61453, Mogoditshane,
of Deeds, Private Bag F72, Francistown within 3 weeks of the last publication of this notice. Kweneng District, Botswana on the 19th July 2021 gmx.com
DATED AT SEROWE THIS 25 DAY OF JUNE 2024
……………………………… NOTICE IS HEREBY GIVEN that Debtors and Creditors in the above Estate are hereby required to pay their ST ARNOLD’S CATHOLIC SCHOOL
APPLICANT debts and file claims of whatever nature with the undersigned within thirty (30) days after the publication seeks a qualified sports teacher to coach
1st PUBLICATION hereof. swimming, gymnastics. basketball and
DATED at _____on this ____Day of _____2024.
other disciplines. Apply before July 25.
______________________________ Manager ST ARNOLD’S SCHOOL. Box
428, Tonota. Tel.72637933
PHYSIOTHERAPIST
The Executrix
Hilda Paidamoyo Gombakomba
Plot 65467 Nkoyaphiri AUTO TRACK IS looking for 4 dentors
Mogoditshane
Tel: 77000793/ 76620830
and 2 mechanics able to do turbo
We are looking for a Physiotherapist with a degree/diploma who is registered with engines. Closing date 5 July 2024.
BHPC, must have a minimum of 5 years working experience. Rehabilitation Technician Tel; 3188123 Email application to
with a certificate minimum 3 years working experience. Marketing Officer with a degree/ reception@autotrack.co.bw Auto track
diploma in marketing and at least 2 years’ experience. POWER CONTROL SYSTEM (PTY) LTD Block 3 Industrial.

Electrical Installation and Maintenance Company GABORONE AUTOMOTIVE PANEL

Beaters & Spray Painters requires the
Applicants are welcome to drop off their documents at Physio Hub KB Mall or forward Wanted Electrical Engineer, Electrical Technicians, Electricians and Linesmen with experience in services of an Auto Electrician with class
their applications to physiohub.botswana@gmail.com. Closing date for applications high voltage substation construction ranging from 132 to 400kv. At least a minimum of five years working 1 in Auto Electrician or above. Atleast
experience in the substation construction work 20 years experience or more. Apply:
is 15 July 2024.
We also looking for the service of Artisans, Rigger/Fitter with experience in assembling and erection of steel Box 237 ABF Gaborone. Closing Date:
structure including installation of all external substation primary equipment like circuit breakers, isolators VTs, 15.07.2024
WE ARE RECRUITING CTs and other equipments. At least 5 years working experience with tangible reference of previous projects LEAD DESIGNER / ARCHITECTURAL
Position: Programs Director – Environmental Justice done. drafter, with minimum 5 years
Please kindly forward your application to P.O. Box 1794 Selebi Phikwe before 30th July 2024 experience. M Arch or BA in Architecture.
The Civil Society Agrarian Partnership (CSAP) is seeking to recruit an Environmental Email: nshumba@powercontrol.co.bw Send CV to impalaprojects@gmail.com.
Compliance Programs Manager for its secretariat office in Francistown. Only shortlisted applicants will be
contacted.
Responsibilities include coordinating the implementation of Environmental NOTICE OF NEXT OF KIN MEETING FOR THE LATE
and Agrarian rights projects in Botswana and the development of community ORAPA UNITED FOOTNALL Club is
MERE THIBATSELA & NOMBULELO THIBATSELA - ESHGB-000505/23 looking for a Midfielder and a Striker.
protocols and ordinances based on Access and Benefit Sharing (ABS) code of
practice.
The players must have National Team
IN PURSUANCE of Section 31 of the Administration of the Estates Act {Cap caps experience. Premier level will be
31:01} the heirs and Next of Kin of the deceased persons specified above hereby an added advantage. Closing date is :15
Qualifications: Master’s degree in environmental policy plus 5 years of experience
invited to attend a Next of Kin Meeting on 26th day of August 2024 at 1200 hours July 2024. Email: semphorileg@gmail.
or a bachelor’s degree in environmental management plus 20 years of experience
at the before - Thato L. Dibeela. At the Master’s Office, Gaborone High Court com or at P.O. BOX 14 Orapa
in a related field. To apply, send resume and academic qualifications to
agrarianpartnership@gmail.com or by post to CSAP in Francistown by 5 July 2024. Building.
Only shortlisted candidates will be contacted
At the respective meeting, the next of kin meeting are to recommend person(s)
to be appointed as Executor(s) / Executives Dative, identify beneficiaries and to PRIMARY
LIQUIDATOR’S
NOTICE
NOTICE OF THE FIRST MEETING OF CREDITORS
OF PRIME CHECK (PTY) LTD – IN PROVISIONAL
discuss any other business relating to the estate of their deceased relative.
TEACHERS
LIQUIDATION MASTER’S REFERENCE – LQHGB – 000007 - 22
APPLICATION FOR A CERTIFIED COPY OF LOST DEED Wanted: 2 Primary School
NOTICE IS HEREBY given that pursuant to section 382(1) of the Companies NOTICE IS HEREBY GIVEN THAT the undersigned intents to apply for a certified copy Of Deed NO:
teachers with a Diploma in
Act 42:01, the First Meeting of Creditors of the above-named company will 1573/2012 Dated 12 Day of July 2012 Made in favour of OAITSE MOKGATITSWANE Primary Education. Suitable
be convened before the Master of the High Court, Gaborone at 14:30 hours CERTAIN : Plot 7190 GHANTSI candidates must have at least
on the 14th of August 2024. The agenda to be discussed is as follows; SITUATE : IN THE GHANZI ADMINISTRATIVE DISTRICT
MEASURING : 375 m2 (Three hundred and Seventy five Square Metre) a minimum of 5 years teaching
• Proof of claims AS WILL MORE : From general Plan D. S. M. No. 2550/2006 experience.
• Consideration of Provisional Liquidator’s Report FULLY APPEAR : surveyed by land Surveyor M. P. Tafa In August – September 2006 And
approved by the Director of Surveys and Mapping On the 25th July 2007
• Remuneration of the Provisional Liquidator
• Appointment of Liquidator
HELD UNDER : Is held under Certificate of Registered State
Tittle No. 1724/ 2009 dated 6th August 2009
Apply To:
• To consider and pass resolutions if deemed fit IN FAVOUR : OF OAITSE MOKGATITSWANE The Manager
• Any other business All persons having objection to the issues of such copy are hereby required to lodge the same in Shepherd Eng Med School,
By the Provisional Liquidator,
writing with the Registrar of Deeds, PRIVATE BAG 0020 GABORONE within three (3) weeks of the
last publication of this notice hereof.
P O Box 1088, Molepolole
Jethro Kamutsi | Prestige Business Consultants (Pty) Ltd DATED AT 12TH ON THIS DAY OF July 2012.
Setlhoa Village, Unit 6, Setlhoa Office Park | P O Box 602 430, Gaborone Oaitse Mokgatitswane | APPLICANT CLOSING DATE 16 JULY 2024.
 Friday June 28, 2024 No. 120 Page 19 DailyNews

ACCESS

FROM ONLINE
PLATFORMS
https://dailynews.gov.bw
& facebook: DailyNewsbw

Call us Visit our website

365 3500 https://dailynews.gov.bw
DailyNews Friday June 28, 2024 No. 120 Page 20

KITSISO YA SECHABA
Kitsiso e e ntshitsweng go ya ka karolo YA LESOME ya molao wa tshekatsheko ya tikologo (CAP 65:07)
KITSISO YA TSHEKATSHEKO YA SECHABA YA PEGO YA TSHEKATSHEKO YA TIKOLOGO YA TIRO/POROJEKE E E AKANTSWENG YA METSI A A LESWE LE GO A DIRISA GAPE KWA
MOKGATHONG WA CAMPHILL, OTSE
Dintlha tsa konokono tse di bonweng mo dipatlisisong tsa tshekatsheko ya Tikologo ya porojeke/tiro e e fa godimo di sobokilwe fa tlase.
i. SELEKANYO LE SEBOPEGO SA TIRO
Go tsenngwa mo tirisong ka botlalo ga tiro/porojeke e e akantsweng e ya metsi a leswe le thulaganyo ya go a dirisa gape go tlaa akaretsa:
• Go phepafadiwa ga metsi a a tswang mo ditankeng tsa kgopelo (septic) tse di setseng di le teng mo dikagong tsa mokgatho wa Camphill tse di tla tsamaisiwang ka mealo (pipes) go ya kwa lefelong le legolo.
• Go tsenngwa ga tanka ya 30m3 e e nang le dikganedi tse di dirisiwang go tsamaisa seelo sa metsi go thibela metsi a a tsenang go tswa mo tankeng ya kgopelo.
• Go agiwa ga dikago tse pedi tsa matlhare a a nang le matlapa a a tsamayang ka tsela e e tlhamaletseng
• Go bolaya megare mo mmetsing a a phepafaditsweng go tlhomamisa gore a tsamaisana le topo ya BOS 463:2011 ya Boleng jwa Metsi a go Nosetsa
Maikaelelo a go diragatsa porojeke/tiro eno ke go tokafatsa tsela e metsi a a leswe a dirisiwang ka yone mo lefelong le, ka go kgobokanya le go phepafatsa leswe le le tswang mo ditankeng tsa kgopelo ya metsi a leswe tse di leng
teng gone jaanong a a tshologelang mo mosimeng o o tsamaisang metsi a a leswe mo lefelong la tiro go ya kwa lefelong la konokono la phepafatso ya metsi a a leswe. Maikaelelo a tlhabololo e ke maiteko a go tokafatsa tsamaiso ya
matlakala le go dirisa gape metsi a a leswe a a phepafaditsweng go nosetsa mo dikagong tsa mokgatho (Trust).
ii. LEFELO LA TIRO
Porojeke/Tiro e e akantsweng ya metsi a leswe le thulaganyo ya go a dirisa gape e tshwanetse go diragadiwa mo dikagong tsa Camphill Community Trust. Lefelo la mokgatho le kwa motseng wa Otse go bapa le tsela e kgologolo ya
Gaborone - Lobatse. Lefelo leno la go phepafatsa metsi le tla agiwa mo lefelong le le bogolo/bophara jwa dimetara di le masome a matlhano (50) ka dimetara di le masome a matlhano (50).
iii. DITLAMORAGO TSE DI KA TLHAGOGANG KA NAKO YA TIRO E, LE METLHALE E E AKANTSWENG GO FOKOTSA MANOKONOKO A TIKOLOGO
Tafole e e fa tlase e bontsha tshoboko ya Ditlamorago tsa Tikologo le Dikgato tsa go di Fokotsa/Tokafatsa.

Ditlamorago Dikgato tsa go Fokotsa ditlamorago /Go Tokafatsa Ditlamorago Dikgato tsa go Fokotsa ditlamorago /Go Tokafatsa
Koketsego ya • Go tshwanetse ga tsewa dikgato tse di lekaneng tsa go thibela lerole go akaretsa Go tlhama ka • Go thapa batho ba le bantsi ba ba tswang mo lefelong leo ka mo go ka kgonegang
lerole go kgatshiwa ka metlha ka metsi segolobogolo mo godimo ga mafelo a a bonalang ditiro tsa nakwana ka teng segolobogolo mo setlhopheng sa batho ba ba nang le bokgoni jo bo kwa
mo lefelong le dikoloi di tla tsamayang mo go lone. tlase le ba ba se nang bokgoni.
• Babereki ba tshwanetse go tlamelwa ka dipiba melomo tse di tshwanetseng tsa • Tumalano ya pereko (contract) e tshwanetse go rurifadiwa ka mokwalo(sign) ke
lerole segolobogolo ka nako ya go epa, go tlatsa gape ka nako ya go diragatsa babereki ba ba sa tswang go thapiwa.
porojeke/tiro go ba thibela go tsenwa ke malwetse a go hema (kgotsa ditshwaetso). • Rakonteraka o tshwanetse go sala morago melao ya tiro.
• Go fokotsa go runya ga lerole, go tshwanetse ga tsewa kgato tsa go dibela lerole • Sephato sa babereki (50%) e tshwanetse go nna bomme le banana.
pele ga tiro le ka nako ya tiro bogolo jang fa go epiwa fa tlase ga matlwana a
borutelo le magae a moalo wa kgopho ya metsi a leswe o fetang teng Go rotloetsa Ka fa go ka kgonegang ka teng le fa go ka kgonegang teng, Rakonteraka o tshwanetse go
itsholelo ya reka didirisiwa tsa go aga lefelo la bonno go tswa go batlamedi ba selegae ka go gatelela
Koketsego ya • Baagi ba ba nnang mo tseleng e go fetang moalo wa kgopho ya metsi a a leswe teng selegae/ya kgaolo go nna le seabe ga selegae.
modumo go ya ko lefelong le le akantsweng la phepafatso ya metsi a a leswe, ba tshwanetse
go itsisiwe malatsi a mabedi pele ga ditiro tse di tlaa ba amang di simolola. Go fokotsega ga Go nna le thulaganyo e e lolameng ya tsamaiso le tlhokomelo ya lefelo go tlhomamisa
• Tlhomamisa gore didirisiwa tsotlhe tse di seng mo tirisong di beilwe ka kelotlhoko bokgoni jwa lefelo gore tsamaiso e e siameng ya go dira ga tsamaiso e go a diragala.
kgakala le mafelo a a ka amegang (matlo a borutelo, bonno) go bapa le moalo wa la go phepafatsa
kgopho ya metsi a leswe. metsi a a leswe
• Fa go kgonegang teng, go tshwanetse ga dirisiwa tiro ya diatla fa go epololwa le
fa go tladiwa gape. Kotsi e e ka • Go tshwanetse ga nna le tlhokomelo ya tikologo ya lefelo le le bokgola ka nako
• Ga go a tshwanela ga dirisiwa metšhini e e bokete fa dithuto di tsweletse. nnang teng ya tsotlhe go tlhomamisa gore ga go na matshwao a mefuta ya letlhaka.
• Babereki ba tshwanetse go tlamelwa ka diaparo tse di lekaneng tsa tshireletso go gore dimela tsa • Tiriso ya melemo e e bolayang dimela go laola mefuta ya ditlhare tsa mogoma tse
akaretsa le dithibo tsa ditsebe fa ba le mo lefelong la tiro. lotlhaka di tsene di tlhaselang e tshwanetse go tilwa. Go tshwanetse ga akanyediwa ditsela tsa go
• Didirisiwa tsotlhe di tshwanetse go tswalwa fa di se mo tirisong. mo mafelong a a dira dilo ka tsela ya go epolola.
dikologileng • Didirisiwa tsotlhe tse di tla dirisiwang ka nako ya fa go tlhokomelwa lefelo le le
Go kgotlelesega • Go phepafatsa lefelo letsatsi le letsatsi go rurifatsa bophepa mo lefelong la tiro bokgola di tshwanetse go phepafadiwa sentle pele le morago ga go tsena mo
ga mmu ka • Go rekwa ga didirisiwa tsa kago tse di tshwanetseng. lefelong leo
ntlha ya go sa • Matlakala otlhe a tshwanetse go kgaoganngwa ka mefuta ya one gore a tle a
tshwarwe sentle dirisiwe gape le go dirwa sesha. Go tlamela ga • Go tlhomamisa gore mafelo a a bokgola a bereka sentle.
ga matlakala a a • *DJRQDPDWODNDODDSHDDWVKZDQHWVHQJJR¿VLZDNJRWVDJRHSHOZDPROHIHORQJ phefo e phepa • Go tlhomamisa gore tsamaiso e tlhokomelwa gangwe le gape le gore go tsewe
thata leo. dikgato tse di maleba ka bonako jo bo ka kgonegang fa go go ka lemogiwa gore ga
• Go tshwanetse ga tlhomiwa lefelo le le lekaneng la go boloka dilo. Go tsena mo e tsamaisanye le melao e e beilweng,
lefelong leno go tshwanetse ga laolwa.
Go tlhagisa • Go tshwanetse ga nna le ditlhatlhobo tsa kgwedi le kgwedi tse di dirwang mo
Kotsi ya go • Go tshwanetse ga nna le tlhatlhobo ya ditshwantsho tsa dikago tse di bapileng le monko o o maswe thulaganyong go akaretsa ditanka tsa kgopelo ya metsi a leswe, moalo ya kgopho
senyega ga tsela ya moalo wa kgopho metsi ya leswe pele le morago ga tiro ya metsi a leswe le mosima o o tsamaisang metsi go tlhomamisa gore ga go na go
dikago/dikago • Go baakanya tshenyo e e lemogilweng go tshwanetse ga dirwa fa tiro e sena go dutla kana go thubega
tse di bapileng le wediwa. • Go tshwanetse ga nna le tlhokomelo ya ka metlha ya lefelo le le bokgola go
lefelo la projeke/ akaretsa go tlosiwa ga matlhare/dimela tse di suleng le go tlhomamisa gore metsi a
tiro elela ka kgololesego mo tsamaisong
Kgonagalo ya • Go tshwanetse ga nna le didirisiwa tse di kgonang go tsewa ka seatla tse di Go fokotsa go • Go tokafatsa thulaganyo eno go ikaegile ka gore go latelwe thulaganyo e e
kgotlelesega ya tsenyang mmu o kgotlelesegileng mo kampeng ya Rakonteraka. ikaega ka metsi a rulagantsweng ya go tlhokomela thulaganyo eno ka metlha gore e kgone go ntsha
mmu • Matsela otlhe a a dirisitsweng a a nang le mafura le dinkgwana tsa mafura tse didiba go nosetsa metsi a a tlhokegang go nosetsa dipolase.
di dirisitsweng di tshwanetse go bolokwa ka nakwana mo teng ga ditanka tse di
dirisitsweng tse di beilweng mo lefelong le le ageletsweng le bopetswe Dikotsi tse di ka • Go tshwanetse ga nna le lebokoso la thuso ya potlako le le tshwailweng sentle, le
• Mafura otlhe, le leokwane di tshwanetse go bolokwa mo dikgamelong tse di nnang teng mo na le didirisiwa tsotlhe tse di tlhokafalang mo kampeng, Didirisiwa tsotlhe tse di mo
tswalwang tse di tshwailweng sentle. Dikgamelo tse di tshwanetse go bewa mo babereking lebokosong di tshwanetse go bewa leitlho le go tladiwa fa go tlhokafala.
lefelong le le sa tseneng metsi mo go lone le le mo lefelong le le sireletsegileng le • Ditiragalo tsa thuso ya ntlha mo kampeng di tshwanetse go kwalwa
le nang le moriti mo tikologong ya kampa. • Tikologo e tshwanetse ya phepafadiwa/tlhokomelwa go fokotsa borai jwa go
• Babereki ba tshwanetse go sedimosediwa letsatsi le letsatsi ka ga go tshwara tlhagelwa ke dikotsi tse di amanang le pereko le tsireletsego ya yone.
sentle leokwane le mafura mo lefelong. • Go tlhomamisa gore tshedimosetso e e maleba le dikgato tsa pabalesego mo
• Mmu otlhe o o kgotlelesegileng o tshwanetse go ntshiwa o bo o tsenngwa mo lefelong la tiro e supilwe sentle kwa kgorong gore botlhe ba kgone go e bona le
ditankeng tse di dirisitsweng go ya go phepafatswa ke kompone e e nang le gore lefelo ka bolone le na le matshwao a a bonalang a pabalesego, jaaka tlhokega.
teseletso ya taolo matlakala. • Babereki ba tshwanetse go tlamelwa ka diaparo tse di lekaneng, di le maleba tsa
tshireletso (PPE), le go rurifatsa gore go nna le tlhokomelo ya ka metlha yotlhe go
Kotsi ya go tlhoga • Didirisiwa tsa pereko le dikoloi di tshwanetse tsa tlhatswiwa thata pele ga di ka netefatsa gore di a dirisiwa mo lefelong la tiro le gore di emisediwa ka nako fa di
le go anamisiwa fudusiwa go tswa mo lefelong le lengwe go ya ko go le lengwe, go thibela kanamo onala.
ga mefuta ya ya dimela le dipeo tsa tsone.
dimela tse di sa • Pele go simololwa tiro ya go aga mo lefelong leo, Rakonteraka o tshwanetse go
tlwaelegang sekaseka mefuta yotlhe ya dimela (ditlhare le ditlhatshana) tse di leng teng mo
lefelong leo. Go tlamela ka • Babereki ba ba tshwanetseng go thapiwa ba tshwanetse go tswa mo motseng wa
• Fa go ka lemogiwa gore go na le mofuta mongwe wa dimela tse di golang ka nako ditiro tsa nakwana Otse.
ya fa go agiwa, di tshwanetse go tlosiwa ka bonako • Rakonteraka o tshwanetse go obamela ditopo tsotlhe tsa melao ya pereko tse di
• Dikoloi tsotlhe di tshwanetse go tlhatlhobiwa letsatsi le letsatsi go tlhomamisa gore leng teng.
ga di na dimela dipe tse di sa tlwaelesegang mo maotwaneng.
• Mefero epe fela e e mo mmung o o kgobokantsweng e tshwanetse go tlosiwa ka
nako tsotlhe

iv.TSHOBOKO
Tshoboko go tswa mo tshekatshekong ya tikologo (EA) e e dirillweng go bontsha gore go na le ditlamorago tse di siameng le tse di sa siamang tse di ka nnang tsa tlhagelela go tswa mo tirong e e akantsweng. Ditlamorago tse di
siameng le tse di sa siamang di bontshiwa mo tafoleng e e fa godimo. Ditlamorago tse di sa itumediseng di ka fokodiwa ka go dirisa metlhale e e akantsweng tsa go fokotsa manokonoko a tikologo. Ditlamorago tse di siameng di ka
tokafadiwa go oketsa mosola kana dipoelo tse di tswang mo porojekeng/tirong e e akantsweng.
v. DIKGAKOLOLO TSA TSAMAISO TIKOLOGO
Morago ga go dirwa ga thuto ya EA, go akantshiwa gore porojeke/tiro e letlelelwe go tswelela pele ka fa tlase ga maemo a gore dikgato tsa tsamaiso tse di tlhomamisitsweng di tsenngwe mo tirisong le go bewa leitlho go ya ka Karolo
18 ya Molao wa EA (CAP 65:07).
vi, MAFELO A GO BEILWENG MOKWALO WA TSHEKATSHEKO TIKOLOGO
Meriti (Copy) ya ditlamorago tsa Tikologo di beilwe mo mafelong a a latelang go sekasekwa ke Sechaba.
1. Motlobo wa dibuka wa lephata la pabalelo Tikologo (Gaborone),
2. Otse Kgotla
vii.DIKAKGELO
Dikakgelo kgotsa dikganetso tse di kwadilweng ke batho ba ba ka amiwang ke tiro eno le batho ba ba nang le kgatlhego di tshwanetse go romelwa kwa: Motsamaisi wa Lephata la Tshireletsego ya Tikologo, Private Bag 0068,
Gaborone, Tel: 3902050, Fax: 3902051 kgotsa di romelwe ka seatla kwa Travaglini House, Plot 1271, Second Floor, Old Lobatse Road kgwedi ya Phukwi e tlhola malatsi a le masome a mararo 2024.
The Director
Department of Environmental Protection
Private Bag 0068
Gaborone
Tel: +(267) 3902050, Fax: 3902051
 Friday June 28, 2024 No. 120 Page 21 DailyNews

MINISTRY OF JUSTICE
(EXTERNAL ADVERTISEMENT)
REF: MoJ 4/7/8 I (18) AG. DPS-CS 25th June 2024

The Ministry of Justice seeks to recruit highly motivated, well experienced and self-driven
applicants to fill the following vacant position.

VACANCY CIRCULAR NO. 5 OF 2024

POST: Deputy Manager – Human Resource Management* 1
Tenable at: Department of Land Tribunal
SALARY SCALE: D1 (P368 460 – P406 332) • Develops plans, strategies and programmes
per annum for Records Management, Security, Applications not accompanied by
Secretarial, Cleaning and Transport all the stipulated documents will
Terms of Employment: Temporary Services.
not be considered.
Employment. • Prepares and or consolidates the Human
Resource Management and administration
NB: Officers to be considered for this
Duration: Twelve (12) months. function budget.
position should be aged between 35 to
• Provides advice and guidance on the
50 years.
BENEFITS: interpretation and application of human
• 30 working days per annum resource management and administration
• Severance benefits. policies to the customers.
Applications should be addressed
• Coordinates preparation of manpower to:
QUALIFICATIONS: estimates/requirements.
To be considered for appointment to this • Identifies staff skills gaps and determines The Permanent Secretary
position, candidates must have a Degree in relevant development programme. Ministry of Justice
Public Administration or Human Resource • Undertakes any other related duties as may Private Bag 00406
Management or its equivalent. be assigned by Management. Gaborone

EXPERIENCE: Twelve (12) years relevant KEY SKILLS AND COMPENTENCIES OR Hand deliver to:
work experience, two (2) years of which • Deciding and initiating action
should have been served as Assistant • Adhering to principles and values Ministry of Justice
Manager – Human Resource Management or • Working with People Fairgrounds Office Park
Administration at D2 level. • Analyzing Plot No 50371, Ground Floor
• Writing and reporting Records Management Unit
MAIN PURPOSE OF THE JOB: • Planning and Organizing Office No. 112.
To provide leadership and management • Delivering results and meeting customer
of the Human Resource Management and expectation NB: Faxed and emailed applications will
Administration functions. • Adapting and responding to Change not be accepted.

KEY PERFORMANCE AREAS Applicants should quote the reference Only shortlisted applicants will be
• Coordinates the human resource Vacancy Circular number and provide the responded to.
management processes of recruitment, following:
training and development, compensation • Full name, address, date and place of birth Closing date: 19th July 2024
and benefits. • Detailed Curriculum Vitae
• Initiates, develops and implements • Date of first appointment, Present post,
For further information, please
long, medium and short term plans and scale and date into current post.
programmes on training and development, • Certified copies of certificates and valid contact the Human Resource
personnel administration and health and Omang. Division on 373 2621 / 22
safety. • At least two recent references. / 23 / 82 / 94
 Dominating The
Stands Since 1962
www.kutlwano.gov.bw

Friday June 28, 2024 No. 120

Kasane strategic for academy

By Mooketsi Mojalemotho

KASANE - Government’s
decision to set up the Botswana
Wildlife Film Academy in
Kasane was meant to immerse
students in the environment that
hosts the world’s best flora and
fauna, says Assistant Minister
for State President Boitumelo
Gofhamodimo.
She made the remarks on
Tuesday during the launch of
the academy in Kasane that if
due care had not been taken in
choosing the school’s location,
very little impact could have
been achieved.
“It was meant to inspire you
and to allow you to understand
the environment you will be
exposed to for the rest of your
lives,” she said to both the
outgoing and incoming wildlife
film and documentary students
at Mowana Hotel.
Moreover, Gofhamodimo said
as much as the genre required
great diligence, attention to
detail, serious planning, and hard
work to yield top-notch, world-
class documentaries, students
were expected to embrace
conservation since the subjects
they would be documenting were
critical resources and wealth
for Botswana and the rest of the
globe.
“The government is making Botswana Wildlife Film Academy second intake students during the school launch in Kasane on Tuesday. Gofhamodimo said a careful
an investment to empower choice of the location for the school was meant to inspire the students and to allow them to understand the environment they would be
you to better serve the nation exposed to for the rest of their lives. Photo: Ogopoleng Kgomoethata
and meaningfully contribute
towards economic growth and
employment creation,” she said who came from different parts help shape the narratives of the up and running. “We have had working tirelessly to establish the
further. of Botswana to appreciate some graduates as they embarked both guides and researchers, and school.
Among the key deliverables of the country’s natural resources on telling ‘uniquely’ Botswana the advent of the school brings That withstanding, Mululwani
under the project is the film as well as the challenges that stories. in filmmakers, which has been called on students to take good
commission framework, which Botswana faces, including the Chobe District Council the missing piece of the puzzle,” care of the environment so that it
resides under the Ministry of human-wildlife conflict, climate Chairperson Chimney he said. Therefore, he thanked could continue to bring in much-
Youth, Gender, Sport and Culture change and the difficulties Mululwani was also happy that Steve Harvey Global and the needed financial resources and
and aims to facilitate the business therein, something she said will the wildlife academy was finally government of Botswana for be preserved for posterity. BOPA
side of filmmaking in Botswana.
The ball was, therefore, in the

Shining Light Awards entries open

court of graduates to employ
their skills to generate content
that will be globally competitive
using the requisite structures
and take advantage of available
programmes designed to support By Ketshepile More designers aged 18-35 years Madondo said the SLA have lasting rapport, answer questions
start-ups. who are in their final year, have evolved over the past years from and inspiring greatness among
All that graduates needed was GABORONE - The entries graduated from a jewellery design being just a jewellery design aspiring participants.
to present compelling business for the De Beers Group Shining programme or have relevant competition to an initiative With the prize pool for this
ideas to get assistance from the Light Awards (SLA) jewelry experience in jewellery design. that celebrates and capacitates year’s competition set at R1.6
government. design competition for 2024 are The theme for this year’s jewellery design talent. million per country, aspiring
Gofhamodimo also stated open, from June 19 to August 16. competition is: Luxury Redefined, He said the awards created participants are urged to visit
that repetitive success stories by A youth beneficiation skills and it recognises the power of new and optimised existing social media pages of SLA on
graduates would instil confidence development initiative by De millennials and Gen Zs to tell facets of the diamond value how to submit their entries.
in the financial sector to invest in Beers Group Designers Initiatives, their story through design. chain from jewellery design and The social media pages are
the genre. the competition aims to inspire, “The theme gives our entrants manufacturing to sales, marketing Facebook handle on Shining
“With time and dedication, ignite and enable young jewellers the space to really create and entrepreneurship. Lights Awards and Instagram on
Botswana should be counted with world-class jewellery design something that accurately reflects The De Beers Group SLA handle Shininglightawards.
among countries that lead in the and manufacturing skills in each their identity and values in today’s hosted in-person workshops Winners from the four producer
wildlife documentary space, just of the De Beers Group diamond era, to define luxury in a brand in May at various institutions countries will be announced
as it does in the related tourism producing countries, which are new way. We are looking forward across Botswana, South Africa in November at a prestigious
sector,” she said. Botswana, South Africa, Namibia to seeing how they will interpret and Namibia engaging with gala awards ceremony in
Gofhamodimo was happy that and Canada. the theme,” said Managing talented students and nurturing Johannesburg, South Africa,
training would enable students The competition runs every two Director of De Beers Managed potential future winners of the following judging by an esteemed
years, and is open to jewellery Operations, Moses Madondo. SLA 2024, with the goal to build international panel. BOPA
 Friday June 28, 2024 No. 120 Page 23

Zebras face Bafana Bafana tomorrow

By Anastacia Sibanda opponents and score.
Da Rosa said it was critical
GABORONE - Botswana that the Zebras played with
senior national football team, confidence against Bafana
Zebras will face Bafana Bafana as they had good players.
Bafana of South Africa in a He said they had to win the
HOLLYWOODBETS COSAFA game at all costs if they wanted
Cup 2024 clash at the Wolfson to go far in the tournament.
Stadium, Gqeberha, South Against eSwatini, he said
Africa tomorrow. though they started the game
The Zebras played to a goalless well and created two scoring
draw against eSwatini in their opportunities, they had a tough
opening game on Wednesday, game.
while Bafana Bafana played He said eSwatini dominated
to one-all draw against the last 20 minutes of the first
Mozambique. This therefore half with an ‘efficient system’
means Group A is anyone’s for adding that it was not easy to
the taking and for the Zebras to control them hence he had to
keep their hopes of continuing change the tactical system in the The Zebras will face Bafana Bafana in a HOLLYWOODBETS COSAFA Cup clash at the Wolfson
with the tournament, they second half. BOPA Stadium in South Africa tomorrow.
will have win their tomorrow
encounter.
Coach Didier Gomes Da Rosa
has travelled with a youthful
PUBLIC PROCUREMENT REGULATORY AUTHORITY PPRA
squad who are talented and
hungry for success and it is upon
them to impress and engrave
MEDIA RELEASE
their names in the hearts of
Batswana. CHALLENGES WITH IPMS
Winning against Bafana
..........................................................................................................................................................................................................
Bafana is always sweet victory
for Batswana and if the
youngsters’ performance on The Public Procurement Regulatory Authority (PPRA) would like to inform all stakeholders that the
Wednesday is anything to go by, Integrated Procurement Management System (IPMS) is currently experiencing some challenges which
then Bafana Bafana are in for a has affected the whole contractor registration process.
rude awakening.
The Zebras have a good
goalkeeper in Victor James, who As a result of the encountered challenges with the system, the PPRA Contractor Registration Unit
can frustrate the opponents at (CRU) is having a backlog in the processing of applications. Contractors are also not able to submit
any given time and the onus will applications online.
be on the striking department to
make runs, put pressure on the
Further, Procuring Entities (PEs) are also not able to verify information through IPMS during tender

Table tennis evaluation.

PPRA is currently working-round the clock to ensure that the system is back to normality, and services

players in are restored.

The PEs, Contractors, and General Members of the Public are encouraged to continuously check the

Luanda for IPMS system as the service might be restored to normality anytime soon from now.

Contractors and PEs needing urgent assistance on contractor registration related matters should
qualifiers contact the following:

By Moshe Galeragwe NO NAME DESIGNATION MOBILE NUMBER

GABORONE - The Botswana 1. Mr. Godira Mmeso Contractor Registration Adjudicator (+267) 72 740 224
Table Tennis Association
(BTTA) senior national team is
in Luanda, Angola to compete 2. Mr. Kebainee Andrew Sengalo Contractor Registration Administrator (+267) 72 993 454
in the Southern Africa Region
World Championship 2024 3. Ms. Antoinette Ragalase Contractor Registration Administrator (+267) 74 458 109
qualifiers.
In an interview, BTTA public 4. Mr. Aaron Moruisi Contractor Registration Assessor (+267) 72 151 417
relations and communications
manager, Tshegofatso Malepa
said the team, comprising eight 5. Ms. Mogomotsi Segolame Contractor Registration Assessor (+267) 77 156 881
players, left on Wednesday for
the four-day qualifier event
billed for June 28 to July 1. Mr. Charles Keikotlhae
Malepa said the event is PPRA Public Relations and Education Manager
expected to test the local table at (+267) 73 991 127 / 360 2017 or ckeikotlhae@ppra.co.bw.
tennis players’ mettle as it would
field the region’s best players.
The men’s team is made
GABORONE FRANCISTOWN
up of Bakang Maloka, Masa
Lesole, Mompati Chabe and Tel: (+267) 360 2000 Tel: (+267) 240 5900
William Olyn and is coached by Fax: (+267) 390 682 Fax: (+267) 240 2256
Boitshwarelo Butale. Postal Address: Private Bag 0058, Gaborone Postal Address: Private Bag 274, Francistown
The women’s team comprises Physical Address: Plot 8913 Maakgadigau Road, Gaborone Physical Address: Plot 13993/4/5, Extension 22, Botswana
the quartet of Tshepiso West Industrial Life Building
Rebatenne, Emmah Lelatisitswe,
Tsholofelo Gaokgalemelwe and
Olorato Ramagapu.
BTTA vice president
technical, Kabo Mosarwe is BOS ISO 9001

the team’s manager and vice

president finance, Oabona BOBS
R DS
BURE

DA

U
A

O F S TA N
n
Raditloko is head of delegation. Ce
rtif
ied
Or
gan
isa
tio

BOPA
Friday June 28, 2024 No. 120 https://dailynews.gov.bw

Relay team
delivers gold
By Anastacia Sibanda
Sibaanda Kebinatshipi, Leungo Scotch, Lee lot of maturity and we also wanted to
Eppie and Bayapo Ndori stopped see how he will handle the pressure
GABORONE- Botswana’s Bo the clock in 3:02.23. going to the Olympics,” he said.
4x400m men’s relay rela team Kenya came second in 3:02.34 and Generally, he said the competition
itts dominance
continued with its do Zambia won a bronze with a time went well although they were areas
in Africa as it won a gold of 3:02.56. where they thought they would have
Connfeder
medal at the Confederation of National team coach, Justice won medals, but things did not go
African Athletics ((CAA
(CAA) Africa Dipeba said in an interview that he according to plan.
Senior Athletics Ch hamp
Championships was happy that the team delivered He said they had hoped that the
held in Doula, Cammeroo
Cameroon. a gold medal as projected. 4x400m women relay team and
The quarttet;
quartet; Collen He said it was not easy as 800m runner, Oratile Nowe would
targ
all countries were targeting deliver medals as well as 200m
Botswana. runner, Tsaone Sebele.
That s why I started with Collen.
“That’s Collen. For the 4x400m wo
“For women, we had
We told him to push hard aand nd he Christine Botlogetswe and Galefele
did that and gave us a lead d,” he
lead,” Moroko who were not no well, that’s
said. why we had to use Oratile
O who I
Dipeba further said he w was believe ran very well,”
impressed by the USA-based d add
Dipeba added.
Eppie as it was his firstt Meanwhile in this
time being part off edition, Botswana
B won
the relay team. six meda
medals, with two
“He has gold medals
med won by
shown a the men’s 4x400m relay
and Victor Ntweng in the
400m hurdl
hurdles.
Three silver medals were
won by Kemorena
Tisang of 400 metres
hurdl
hurdles, 400m
runn
runner, Eppie
and Kethobogile
Hai
Haingura in
800
800m while the
4x4
4x400m mixed
rel
relay won a
br
bronze. BOPA