ECE/TRANS/SC.3/172/Rev.

ECONOMIC COMMISSION FOR EUROPE

INLAND TRANSPORT COMMITTEE

Working Party on Inland Water Transport

RECOMMENDATIONS ON HARMONIZED
EUROPE-WIDE TECHNICAL REQUIREMENTS
FOR INLAND NAVIGATION VESSELS

Resolution No. 61

Revision 1

UNITED NATIONS
New York and Geneva, 2011
 NOTE

Symbols of United Nations documents are composed of capital

letters combined with figures. Mention of such a symbol indicates
a reference to a United Nations document.

* * *
The designations employed and the presentation of the material in
this publication do not imply the expression of any opinion
whatsoever on the part of the Secretariat of the United Nations
concerning the legal status of any country, territory, city or area, or
of its authorities, or concerning the delimitation of its frontiers or
boundaries.

Including the amendments introduced by resolutions Nos. 64, 65

and 68 of the Working Party on Inland Water Transport

ECE/TRANS/SC.3/172/Rev.1

UNITED NATIONS PUBLICATION

Sales No. E.11.II.E.12
ISBN 978-92-1-117049-8
e-ISBN 978-92-1-054916-5
 FOREWORD

The Pan-European requirements for the construction of inland navigation vessels were first
harmonized in 1975 with the adoption by the United Nations Economic Commission for Europe
(UNECE) of the Recommendations on Technical Requirements for Inland Navigation Vessels
(Resolution No. 17).

Since that time, the Recommendations were continuously updated in the light of the
legislation of the UNECE member States and the European Union (EU) and the regulations of
international river commissions.

Two Pan-European ministerial conferences on inland waterway transport (Budapest, 1991;

Rotterdam, 2001) urged the UNECE to intensify its work on the Pan-European harmonization of
technical, safety and manning requirements, which it carries out jointly with the EU and the river
commissions. As a result, the UNECE Working Party on Inland Water Transport undertook a
fundamental revision of its 1975 Recommendations and, at its special session in March 2006,
adopted the Recommendations on Harmonized Europe-Wide Technical Requirements for Inland
Navigation Vessels (annex to Resolution No. 61). These Recommendations establish a Pan-
European regime of technical requirements for inland navigation vessels that transport goods and
passengers internationally. They are the result of Government efforts to unify the divergent
regulations in force in different intergovernmental organizations and UNECE member countries.

The requirements are in line with EU legislation. They are intended to facilitate the
recognition of ship's certificates, thus eliminating the need for more than one inspection of
vessels engaged in international transport by inland waterways.

The Recommendations also contain strict regulations on limitation of air and water
pollution and on the abatement of noise. They also include the internationally agreed standards
for minimum manning requirements and the working and rest hours of crews.

This publication is the first revision of Resolution No. 61, as amended by Resolutions Nos.
64, 65 and 68 of the Working Party on Inland Water Transport
(ECE/TRANS/SC.3/172/Amends.1–3). The main purpose of the current revision is to keep the
Recommendations up to date, especially in the light of relevant developments in the EU and the
legislation of the river commissions.

- iii -
 RECOMMENDATIONS ON HARMONIZED EUROPE-WIDE TECHNICAL
REQUIREMENTS FOR INLAND NAVIGATION VESSELS

Resolution No. 61
(adopted by the Working Party on Inland Water Transport
on 16 March 2006)

The Working Party on Inland Water Transport,

Considering Resolution No. 17, revised (TRANS/SC.3/103, annex 1), containing in its
annex the Recommendations on Technical Requirements for Inland Navigation Vessels as
amended (TRANS/SC.3/104 and Adds.1–6),
Considering also resolution No. 33 (TRANS/SC.3/131) on Ship’s Certificate,
Recalling the recommendation of the Inland Transport Committee that the Working Party
should continue its efforts towards a full reciprocal recognition of ship’s certificates and should,
to this end, undertake updating the Recommendations on Technical Requirements for Inland
Navigation Vessels (ECE/TRANS/97, paragraph 104),
Recalling further the Declaration adopted by the Pan-European Conference on Inland
Waterway Transport (Rotterdam, 5–6 September 2001) inviting the European Commission,
UNECE and the two river commissions to intensify their cooperation on Pan-European
harmonization of technical, safety and manning requirements (TRANS/SC.3/2001/10, point 12),
Believing that the harmonization of national and international (within subregional
groupings) technical requirements for vessels applied on European inland waterways would be
of great benefit to international transport by inland waterway, the safety of navigation, the
protection of human health and life, as well as the protection of the environment,
Bearing in mind the report of the Working Party on the Standardization of Technical and
Safety Requirements in Inland Navigation, on its twenty-ninth session in so far as the item on the
amendment of the Recommendations on Technical Requirements for Inland Navigation Vessels
is concerned (TRANS/SC.3/WP.3/58, paragraphs 4–22),
1. Adopts the text of Recommendations on Harmonized Europe-Wide Technical
Requirements for Inland Navigation Vessels annexed to this resolution,
2. Decides to cancel Resolution No. 17, revised, as well as Resolutions Nos. 10, 11, 23,
28, 32, 33, 34, 36, 38, 42, 50, 53, 55 and 56 which are replaced by this Resolution,
3. Requests Governments to accept the ship's certificate issued in accordance with the
annexed Recommendations as documentary evidence that the vessel complies with the
Recommendations on Harmonized Europe-Wide Technical Requirements for Inland Navigation
Vessels (as set out in document ECE/TRANS/SC.3/172 as amended) and to take it duly into
account when issuing other certificates, if required, for given waterways. In this connection,
technical inspection of the vessel may be wholly or partly dispensed with, in so far as regulations
in force so permit;

- iv -
 4. Invites Governments to inform the Executive Secretary of the Economic Commission
for Europe whether they accept this Resolution,
5. Requests the Executive Secretary of the United Nations Economic Commission for
Europe to place the question of the application of this Resolution periodically on the agenda of
the Working Party on Inland Water Transport.

* * *

-v-
 CONTENTS

Page
Chapter 1 General provisions ........................................................................................... 1
Chapter 2 Procedure and rules for the inspection of inland navigation vessels ............... 11
Chapter 3 Shipbuilding requirements ............................................................................... 17
Chapter 3A Fire protection .................................................................................................. 27
Chapter 4 Safety clearance, freeboard and draught marks ............................................... 29
Chapter 5 Manoeuvrability ............................................................................................... 35
Chapter 6 Steering gear .................................................................................................... 37
Chapter 7 Wheelhouse...................................................................................................... 41
Chapter 8 Engine design ................................................................................................... 47
Chapter 8A Exhaust and pollutant particulate emissions from diesel engines.................... 55
Chapter 8B Prevention of water pollution and abatement of noise produced by vessels ... 59
Chapter 9 Electrical installations ...................................................................................... 63
Chapter 10 Equipment ........................................................................................................ 77
Chapter 11 Working spaces ................................................................................................ 89
Chapter 12 Crew accommodation ...................................................................................... 93
Chapter 13 Fuel-fired heating, cooking and refrigerating equipment (Left void) .............. 96
Chapter 14 Liquefied gas installations for domestic purposes ........................................... 97
Chapter 15 Special provisions for passenger vessels ......................................................... 103
Chapter 15A Specific requirements for sailing passenger vessels (Left void)...................... 130
Chapter 16 Specific requirements applicable to vessels intended to form part of a
pushed or towed convoy or of a side-by-side formation.................................. 131
Chapter 17 Specific requirements applicable to floating equipment (Left void) ............... 133
Chapter 18 Specific requirements applicable to worksite craft (Left void)........................ 133
Chapter 19 Specific requirements applicable to historic vessels (Left void) ..................... 133
Chapter 19A Specific requirements applicable to canal barges (Left void).......................... 133
Chapter 19B Specific requirements applicable to craft navigating on zone 4 (Left void) .... 133
Chapter 20 Specific requirements applicable to sea-going ships ....................................... 135
Chapter 21 Specific requirements applicable to recreational craft ..................................... 137

- vi -
 CONTENTS
Page
Chapter 22 Stability of vessels carrying containers............................................................ 139
Chapter 22A Specific requirements applicable to craft longer than 110 m (Left void) ........ 142
Chapter 22B Specific requirements applicable to high-speed vessels .................................. 143
Chapter 23 Crews ............................................................................................................... 147
Chapter 24 Transitional and final provisions (Left void) ................................................... 158

Appendix 1 List of European inland waterways divided geographically into zones 1, 2

and 3................................................................................................................. 159
Appendix 2 Model ship’s certificate.................................................................................... 183
Appendix 3 Safety signs and signals to be used on board inland navigation vessels.......... 197
Appendix 4 Alternative manoeuvrability test procedures and criteria in accordance
with 5-2.1 ......................................................................................................... 199
Appendix 5 Model of a service record ................................................................................ 235
Appendix 6 Criteria for the approval of Classification Societies ........................................ 249
Appendix 7 Requirements concerning lights and the colour of signal lights on vessels,
intensity and range of signal lights on vessels and general technical
specifications applicable to radar equipment................................................... 251

- vii -
 ECE/TRANS/SC.3/172/Rev.1
page 1

CHAPTER 1
GENERAL PROVISIONS
1-1 PURPOSE AND SCOPE
1-1.1 The purpose of this text is to provide recommendations on the design and equipment
of inland navigation vessels with a view, in particular, to promoting the safety of vessels and
crews; this text is not a substitute for national laws and regulations.
1-1.2 In general, these Recommendations shall, with due regard to definitions in 1-2, apply
to:
(i) Vessels having a length L of 20 meters or more;
(ii) Vessels for which the product of L x B x T is a volume of 100 m3 or more.

1-1.3 These Recommendations shall also apply, with due regard to definitions in 1-2, to
all:
(i) Tugs and pushers, designated to tow or to push or to move alongside vessels
as referred to in 1-1.2;
(ii) Vessels intended for passenger transport which carry more than 12 people in
addition to the crew.
1-1.4 In general, these Recommendations shall not apply to:
(i) Ferries;
(ii) Naval vessels.
1-1.5 For the purpose of these Recommendations, European inland waterways shall be
classified as follows:
Zone 1 (wave height of up to 2.0 m): the waterways listed in chapter I of appendix 1
to these Recommendations;
Zone 2 (wave height of up to 1.2 m): the waterways listed in chapter II of appendix 1
to these Recommendations;
Zone 3 (wave height of up to 0.6 m): the waterways listed in chapter III of appendix
1 to these Recommendations.
On inland waterways not listed in appendix 1 as belonging to navigational zones 1, 2
or 3, Administrations may establish technical requirements which differ from the provisions of
these Recommendations. Such technical requirements should be adapted to the geographical,
hydrological and navigational conditions prevailing on the respective inland waterway and
should be equally applied to all vessels navigating on this waterway. It is understood, however,
that vessels allowed to navigate on inland waterways belonging to zones 1, 2 and 3, satisfy the
safety requirements applied on those unclassified inland waterways with the exception of the
lakes Ladoga and Onega in the Russian Federation.
1-1.6 Unless otherwise stated, the provisions of the present Recommendations shall apply
to new vessels that are intended to navigate in the navigational zones mentioned in 1-1.5,
ECE/TRANS/SC.3/172/Rev.1
page 2

differentiated by the maximum significant wave height 1 corresponding to a 5 % probability of

over-topping.
1-1.7 These provisions shall apply to existing inland navigation vessels so long as the
Administration considers them reasonable and practicable.
1-1.8 The Administration may permit derogations from these provisions for limited
journeys of local interest or in harbour areas. The derogations in question and the journeys or
area for which they are valid shall be specified in the ship’s certificate.
1-1.9 Vessels intended for the carriage of dangerous goods shall also satisfy the European
Agreement concerning the International Carriage of Dangerous Goods by Inland Waterways
(ADN).

1-2 DEFINITIONS
Types of vessels
1. “Vessel”: an inland waterway vessel or sea-going ship;
2. “Inland waterway vessel”: a vessel intended solely or mainly for navigation on inland
waterways;
3. “Tug”: a vessel specially built to perform towing operations;
4. “Pusher”: a vessel specially built to propel a pushed convoy;
5. “Towed barge”: a dumb barge or tank barge built to be towed, either having no motive
power of its own or having only sufficient motive power to perform restricted manoeuvres;
6. “Pushed barge”: a tank barge or cargo barge built or specially modified to be pushed, either
having no motive power of its own or having only sufficient motive power to perform restricted
manoeuvres when not part of a pushed convoy;
7. “Ship-borne barge”: a pushed barge built to be carried aboard sea-going ships and to
navigate on inland waterways;
8. “Passenger vessel”: a day-trip or cabin vessel constructed and equipped to carry more than
12 passengers;
9. “Day-trip vessel”: a passenger vessel without overnight passenger cabins;
10. “Cabin vessel”: a passenger vessel with overnight passenger cabins;
11. “High-speed vessel”: a motorized vessel, with the exception of small craft, capable of
sailing at a speed greater than 40 km/h in relation to the surface of still water, when this is stated
in its ship’s certificate;
12. “Floating equipment”: a floating structure carrying working gear such as cranes, dredging
equipment, pile drivers or elevators;


1
In this provision, “significant wave height” means the average of heights of 10 % of the total number of waves
having the greater heights measured between wave trough and wave crest, observed over a short period.
 ECE/TRANS/SC.3/172/Rev.1
page 3

13. “Ship’s boat”: a boat used for multipurpose application including transportation of people
or cargoes as well as in rescue purposes complying with the requirements of the Basin
administration or the European Standard;
14. “Flush-deck vessel”: a vessel which has no superstructure on its freeboard deck;
15. “Vessel carrying fixed containers”: vessels all of whose containers are fixed and having the
equipment necessary to secure containers to the satisfaction of the Administration;

Assemblies of vessels
16. “Convoy”: a rigid or towed convoy of vessels;
17. “Formation”: the manner in which a convoy is assembled;
18. “Rigid convoy”: a pushed convoy or side-by-side formation;
19. “Pushed convoy”: a rigid assembly of vessels of which at least one is positioned in front of
the one or two vessels providing the power for propelling the convoy, known as the “pusher(s)”;
a convoy composed of a pusher and a pushed vessel coupled so as to permit guided articulation
is also considered as rigid;
20. “Side-by-side formation”: an assembly of vessels coupled rigidly side by side, none of
which is positioned in front of the vessel propelling the assembly;
21. “Towed convoy”: an assembly of one or more vessels, floating establishments or
assemblies of floating material towed by one or more self-propelled vessels forming part of the
convoy;

Particular areas on board

22. “Machinery space”: is the part of the vessel housing the main and auxiliary machinery.
The machinery space can be divided up into a main engine room, an engine room and a boiler
room;
23. “Main engine room”: the space where the main machinery is installed;
24. “Engine room”: the space where only auxiliary machinery, namely internal combustion
engines, is installed;
25. “Boiler room”: the space housing a fuel-operated installation designed to produce steam or
to heat a thermal fluid;
26. “Superstructure”: a decked structure on the freeboard deck which extends from side to side
of the vessel or whose side walls are not set inboard of the ship’s sides by more than 4 % of the
breadth ( B );
An enclosed superstructure is a superstructure:
having closed bulkheads of sufficient strength, permanently so assembled with the deck as
to be watertight;
in which the access openings, if any, in these bulkheads are fitted with watertight doors;
in which all other openings in the sides or ends are fitted with watertight closures;
ECE/TRANS/SC.3/172/Rev.1
page 4

The height of a superstructure is the mean vertical distance measured at the sides from the top of
the freeboard deck beams to the top of the superstructure deck beams;
The length of a superstructure is the mean length of that part of the superstructure which lies
within the length ( L );
If the superstructure is set in from the ship’s plating, the length shall be multiplied by the ratio of
the breadth of the superstructure at the middle of its length to the breadth of the ship at the
middle of the length of the superstructure;
A forecastle and a poop are superstructures which extend to the forward and the after
perpendicular, respectively;
27. “Deckhouse”: a decked structure on the freeboard deck or a superstructure deck whose side
walls are set inboard of at least one of the ship’s sides by more than 4 % of the
breadth ( B );
28. “Wheelhouse”: the area which houses all the control and monitoring instruments necessary
for manoeuvring the vessel;
29. “Accommodation”: a space intended for the use of persons normally living on board,
including galleys, storage space for provisions, toilets and washing facilities, laundry facilities,
ante-rooms and passageways, but not the wheelhouse;
30. “Passenger area”: areas on board intended for passengers and enclosed areas such as
lounges, offices, shops, hairdressing salons, drying rooms, laundries, saunas, toilets, washrooms,
passageways, connecting passages and stairs not encapsulated by walls;
31. “Control centre”: a wheelhouse, an area which contains an emergency electrical power
plant or parts thereof or an area with a centre permanently occupied by on-board personnel or
crew members, like for fire alarm equipment, remote controls of doors or fire dampers;
32. “Stairwell”: the well of an internal staircase or of a lift;
33. “Lounge”: a room of an accommodation or a passenger area. On board passenger vessels,
galleys are not regarded as lounges;
34. “Galley”: a room with a stove or a similar cooking appliance;
35. “Store room”: a room for the storage of flammable liquids or a room with an area of over
4 m2 for storing supplies;
36. “Hold”: part of the vessel, bounded fore and aft by bulkheads, opened or closed by means
of hatch covers, intended for the carriage of goods, whether packaged or in bulk, or for housing
tanks not forming part of the hull;
37. “Fixed tank”: a tank joined to the vessel, the walls of the tank consisting either of the hull
itself or of a casing separate from the hull;
38. “Passageway”: an area intended for the normal movement of persons and goods;
39. “Safe area”: the area which is externally bounded by a vertical surface running at a
distance of 1/5 BWL parallel to the course of the hull in the line of maximum draught;
 ECE/TRANS/SC.3/172/Rev.1
page 5

40. “Muster areas”: areas of the vessel which are specially protected and in which passengers
muster in the event of danger;
41. “Evacuation areas”: part of muster areas of the vessel from which evacuation of persons
can be carried out;

Marine engineering terms

42. “Main machinery”: is that designed to drive the propelling mechanisms and/or serving the
main purpose of the vessel;
43. “Auxiliary machinery”: is that which contributes to the operation of the main machinery
and that which supplies the vessel with all forms of power necessary for the operation of the
vessel’s various systems and installations;
44. “Draught ( T )”: the vertical distance in m between the lowest point of the hull or the keel
and the plane of maximum draught;
45. “Plane of maximum draught”: the water plane corresponding to the maximum draught at
which the vessel is authorized to navigate;
46. “Safety clearance”: the vertical distance measured between the plane of maximum draught
and the lowest point above which, disregarding water intakes and outlets, the vessel can not be
deemed watertight;
47. “Residual safety clearance”: the vertical clearance available, in the event of the vessel
heeling over, between the water level and the lowest point of the immersed side, beyond which
the vessel is no longer regarded as watertight;
48. “Moulded depth ( D )”: the vertical distance measured from the top of the horizontal keel to
the top of the freeboard deck beam amidships at the vessel's side;
49. “Freeboard”: is the vertical distance measured amidships between the upper edge of the
deck line as defined in paragraph 4-4.1.1 and the maximum draught level;
50. “Residual freeboard”: the vertical clearance available, in the event of the vessel heeling
over, between the water level and the upper surface of the deck at the lowest point of the
immersed side or, if there is no deck, the lowest point of the upper surface of the fixed ship's
side;
51. “Freeboard deck”: the deck from which the freeboard is measured shall normally be the
uppermost complete deck exposed to the weather, up to which the watertight bulkheads of the
hull extend and below which all openings in the ship’s sides are fitted with permanent watertight
closures;
In vessels having a discontinuous freeboard deck, the lowest part of the exposed deck and the
continuation of that deck parallel to the upper part of the deck shall be taken as the freeboard
deck;
52. “Margin line”: an imaginary line drawn on the side plating not less than 10 cm below the
bulkhead deck and not less than 10 cm below the lowest non-watertight point of the ship's side.
ECE/TRANS/SC.3/172/Rev.1
page 6

If there is no bulkhead deck, a line drawn not less than 10 cm below the lowest line up to which
the outer plating is watertight shall be used;

53. “Water displacement ( ∇ )”: the immersed volume of the vessel in m³;
54. “Displacement ( Δ )”: the total weight of the vessel, inclusive of cargo, in t;

55. “Block coefficient ( C B )”: the ratio between the water displacement and the product of
length LWL , breadth BWL and draught T ;

56. “Lateral plane above water ( AW )”: lateral plane of the vessel above the waterline in m²;

57. “Bulkhead deck”: the deck to which the required watertight bulkheads are taken and from
which the freeboard is measured;
58. “Bulkhead”: a wall of a given height, usually vertical, partitioning the vessel and bounded
by the bottom of the vessel, the plating or other bulkheads;
59. “Transverse bulkhead”: a bulkhead extending from one side of the vessel to the other;
60. “Wall”: a dividing surface, usually vertical;
61. “Partition wall”: a non-watertight wall;
62. “Length ( L )”: the maximum length of the hull in m, excluding rudder and bowsprit;

63. “Length of waterline ( LWL )”: the length of the hull in m, measured at the maximum draught;

64. “Breadth ( B )”: the maximum breadth of the hull in m, measured to the outer edge of the
shell plating (excluding paddle wheels, rub rails, and similar);

65. “Breadth overall ( BOA )”: the maximum breadth of the vessel in m, including all fixed
equipment such as paddle wheels, rub rails, mechanical devices and the like;

66. “Breadth of waterline ( BWL )”: breadth of the hull in m, measured from the outside of the
side plating at the maximum draught line;
67. “Height ( H )”: the shortest vertical distance in m between the lowest point of the hull or
the keel and the lowest point of the deck on the side of the vessel;
68. “Forward perpendicular”: the vertical line at the forward point of the intersection of the
hull with the maximum draught line;
69. “Clear width of side deck”: the distance between the vertical line passing through the most
prominent part of the hatch coaming on the side deck side and the vertical line passing through
the inside edge of the slip guard (guard-rail, foot rail) on the outer side of the side deck;
70. “Liquid cargo”: all liquids carried on the vessel, including: cargo, stores, ballast, etc.;
71. “Stores”: cargo consumed in the operation of the vessel (fuel, lubricating oil, fresh water,
provisions, etc.);
 ECE/TRANS/SC.3/172/Rev.1
page 7

72. “Empty vessel”: a vessel that is fully prepared and equipped with machinery and systems,
but with no cargo, passengers, liquid ballast or stores;

73. “Critical angle ( ϕ fl )”: angle of heel at which water begins to fill the vessel through
unsecured openings, but not exceeding the angle at which the edge of the freeboard deck is
submerged, or at which the middle of the bilge leaves the water;

74. “Capsizing angle ( ϕ c )”: angle of heel at which the vessel begins to capsize under the effect
of the heeling moment;

75. “Permissible angle ( ϕ perm )”: angle of heel which should not be exceeded and which should
be prescribed by the competent authority for the type of vessel under consideration. In general it
corresponds to the critical angle ϕ fl , but should not be greater than the capsizing angle ϕ c ;

76. “Amidships”: is at the middle of the length ( L );

Steering system
77. “Steering gear”: all the equipment necessary for steering the vessel, such as to ensure the
manoeuvrability laid down in chapter 5;
78. “Rudder”: the rudder or rudders, with shaft, including the rudder quadrant and the
components connecting with the steering apparatus;
79. “Steering apparatus”: the part of the steering gear which produces the movement of the
rudder;
80. “Drive unit”: the steering-apparatus control, between the power source and the steering
apparatus;
81. “Power source”: the power supply to the steering control and the steering apparatus
produced by an on-board network, batteries or an internal combustion engine;
82. “Steering control”: the component parts of and circuitry for the operation of a power-drive
unit;
83. “Steering apparatus control unit”: the control for the steering apparatus, its drive unit and
its power source;
84. “Manual drive”: a system whereby manual operation of the hand wheel, moves the rudder
by means of a mechanical or hydraulic transmission, without any additional power source;
85. “Manually-operated hydraulic drive”: a manual control actuating a hydraulic transmission;
86. “Rate-of-turn regulator”: equipment which automatically produces and maintains a given
rate of turn of the vessel in accordance with preselected values;
87. “Radar equipment”: means electronic assistance to navigation intended for the detection
and representation of the environment and traffic;
ECE/TRANS/SC.3/172/Rev.1
page 8

88. “Inland ECDIS”: means a standardized Electronic Chart Display and Information System
for inland navigation, displaying selected information from an Inland System Electronic
Navigational Chart drawn up by the manufacturer and, optionally, information from other vessel
sensors;
89. “Inland ECDIS equipment”: means equipment intended for the display of inland electronic
navigational charts in the following two operational modes: Information Mode and Navigation
Mode;
90. “Information Mode”: means the use of the Inland ECDIS for information purposes only
without overlaid radar image;
91. “Navigation Mode”: means the use of the Inland ECDIS for conning the vessel with
overlaid radar image;

Electrical equipment and automation

92. “Earthing”: means electrical connection to the mass of the hull;
93. “Hull return”: the distribution of direct or alternating current is said to be of the “hull
return” type when the insulated conductors are connected to one of the feed poles and the hull or
superstructure is connected to the other pole;
94. “Safe voltage”: means a voltage presenting no danger to persons. This condition shall be
deemed to be satisfied if the windings of transformers, converters and other voltage-reducing
devices are electrically separate and the reduced voltage of such devices or the voltage of sources
of electric power does not exceed 50 V between the poles in the case of direct current, or
between phases in the case of alternating current;
95. “Automated power installation”: is an installation equipped with automatic control,
monitoring and protection of the main and auxiliary machinery and related systems
interconnected by remote signalling devices;
96. “Automation system”: is the complex of automation elements, appliances and connections
intended for performing prescribed functions in the field of control and monitoring;
97. “Automated remote control system”: is an automation system that provides control and
monitoring of the operation of the vessel’s machinery from a remote control station by means of
single manipulating of the control element (e.g. handle) by the operator and performs
automatically all intermediate operations on preparation for putting into operation, switching on,
changing operation modes, reversal, blocking and switching off the main and auxiliary
machinery and its systems;
98. “Remote control system”: is an automation system that provides control and monitoring of
the operation of an individual vessel’s machinery from a remote control station by means of
manipulating the control element by the operator for performing all operations including
intermediate ones;
99. “Alarm system”: is an automation system that provides actuating visual and acoustic
signals when the controlled parameters reach the limit values or deviations from normal working
ranges of the power installation occur;
 ECE/TRANS/SC.3/172/Rev.1
page 9

100. “Safety system”: is an automation system that provides a certain automatic influence on
the controlled installation in order to prevent its failure;
101. “Element of an automation system”: is electric, electronic or other device being the part of
the automation system (sensor, relay, amplifier, chip, logic element, etc.);
102. “Indicator system”: is one that provides the operator with current information on the
monitored physical parameters of the installation (mechanism, system) and changes in these
parameters, and is capable of being incorporated into the overall system of automation;

Properties of structural components and materials

103. “Sprayproof”: a device shall be deemed sprayproof if, under all weather conditions
encountered in the assigned zone, it allows only a small quantity of water to enter the vessel;
104. “Watertight”: a structural component or device fitted out in such a manner as to prevent
any ingress of water;
105. “Gastight”: a structural component or device so fitted as to prevent the ingress of gas and
vapours;
106. “Non-combustible”: a substance which neither burns nor produces flammable vapours in
such quantities that they ignite spontaneously when heated to approximately 750 °C;
107. “Flame-retardant”: material which does not readily catch fire, or whose surface at least
restricts the spread of flames pursuant to the procedure referred to in section 15-11.1;
108. “Fire-resistance”: the property of structural components or devices as certified by test
procedures according to section 15-11.1;

Other definitions
109. “Oil-containing water”: mixture of water and any quantity of oil formed in the course of
operation of a vessel, except for cargo waste;
110. “Domestic waste water”: waste water from galleys, messes, bathrooms (showers and wash
basins) or laundries, and human waste water;
111. “Vessel operation refuse”: waste formed in the course of operation of the vessel except for
cargo waste;
112. “Household refuse”: organic and inorganic household waste (e.g. remains of food, paper,
glass and similar kitchen waste) which does not contain vessel operation refuse;
113. “Collective life-saving appliances”: lifeboats, liferafts, ship’s boats and life-saving
buoyancy aids intended for rescue of passengers and the ship’s crew;
114. “Lifeboat”: a boat intended for rescue of people in distress complying with the
requirements of the Basin administration, a recognized Classification Society or the International
Life-Saving Appliance Code (LSA) of IMO;
ECE/TRANS/SC.3/172/Rev.1
page 10

115. “Liferaft”: a raft intended for rescue of people in distress, keeping them out of the water
complying with the requirements of the Basin administration, a recognized Classification Society
or the International Life-Saving Appliance Code (LSA) of IMO;
116. “Life-saving buoyancy aids”: means intended for supporting several persons overboard on
the water surface;
117. “Individual life-saving appliances”: means intended for supporting a person overboard on
the water surface. They include lifejackets and lifebuoys;
118. “Ship’s certificate”: a certificate in accordance with the model of appendix 2 signifying the
compliance of the vessel with the technical provisions of these Recommendations;
119. “Recognized Classification Society”: a Classification Society which has been approved in
accordance with the criteria in appendix 6 or which has been recognized by the Administration in
accordance with the procedure, conditions and criteria laid down in chapter 1.15 of the
regulations annexed to the ADN Agreement;
120. “Administration”: the Administration of the country in which the vessel is registered, or
which issues the ship’s certificate;
121. “Basin administration”: the national or international organization that is competent to
decide regulations on waterways within a geographical area;
122. “New vessel”: a vessel the keel of which is laid, or which is at a comparable stage of
construction, on or after the date of entry into force of these Recommendations decided by the
Administration;
123. “Existing vessel”: a vessel in the possession of a valid ship’s certificate or another
permission to navigate on the day before the entry into force of these Recommendations decided
by the Administration;
124. “Shipboard personnel”: all employees on board a passenger vessel who are not members of
the crew;
125. “Persons with reduced mobility”: persons facing particular problems when using public
transport, such as the elderly and the handicapped and persons with sensory disabilities, persons
in wheelchairs, pregnant women and persons accompanying young children;
126. “Lanterns”: a lantern is a device for distributing the flux from a light source; it also
includes the components needed to filter, refract or reflect the light, and hold or operate the light
source. Lanterns intended to give signals on board a vessel are called signal lanterns.
127. “Signal lights”: signal lights are the light signals emitted by signal lanterns.
128. “Light sources”: light sources are electrical or non-electrical devices designed to produce
light flux in signal lanterns.
 ECE/TRANS/SC.3/172/Rev.1
page 11

CHAPTER 2
PROCEDURE AND RULES FOR THE INSPECTION
OF INLAND NAVIGATION VESSELS
2-1 OPERATING ABILITY
2-1.1 Vessels shall be suitable for operation.
2-1.2 Vessels shall be deemed as suitable for operation if they carry a valid ship’s
certificate certifying compliance with the provisions of these Recommendations concerning
construction, installations and equipment of vessels with due regard of 1-1.7.
2-1.3 The ship’s certificate shall be issued by the Administration or by a competent
authority duly authorized to this purpose by the Administration.

2-2 PURPOSE OF THE INSPECTION

2-2.1 The inspection shall:
2-2.1.1 ensure that the vessel is in all respects satisfactory and suitable for operation in the
zone(s) specified in the ship’s certificate with due regard to the intended service and possible
restrictions relating to the operation of the vessel;
2-2.1.2 ensure the maintenance of conditions mentioned in paragraph 2-2.1.1 above for
vessels already holding a ship’s certificate;
2-2.1.3 ensure that the markings required for the identification of the vessel are in place such
as draught marks and registration number.

2-3 KINDS OF INSPECTION

2-3.1 Vessels shall be subjected to the inspections specified below:
2-3.1.1 an inspection before the issuance of a ship’s certificate to a vessel for the first time
(initial inspection);
2-3.1.2 a periodical inspection carried out at regular intervals after the certification;
2-3.1.3 a special inspection carried out after major repairs or refitting of the structure which
have the effect of altering the main technical characteristics of the vessel, and also in case of
change of the mode or area of operation of the vessel or designation of new restrictions relating
to the operation of the vessel;
2-3.1.4 on the order of the competent authority, if it is suspected that the vessel is no longer
suitable for operation (inspection ex officio).

2-4 PERIODIC INSPECTION

2-4.1 For the renewal of the ship’s certificate a periodic inspection shall be carried out on a
request by the owner of the vessel in good time before the expiry of its period of validity.
2-4.2 The ship’s certificate shall be renewed only if the periodic inspection has ensured
that the vessel is suitable for operation as stipulated in paragraph 2-1.2 above.
ECE/TRANS/SC.3/172/Rev.1
page 12

2-5 COMPETENT AUTHORITY ON THE INSPECTION OF VESSELS

2-5.1 The inspection of vessels intended for use on inland waterways is carried out by the
competent authority on the inspection of vessels or qualified bodies, duly authorized by the
Administration.

2-6 ADDITIONAL REQUIREMENTS IN THE COURSE OF THE INSPECTION

2-6.1 The competent authority may demand:
2-6.1.1 an inspection out of the water;
2-6.1.2 trial-trips;
2-6.1.3 a mathematical proof of the strength of the hull;
2-6.1.4 a proof of stability and of other vessel’s characteristics, for example an inclining
experiment, if it is necessary for the inspection of the suitability for operation.
2-6.2 The competent authority may refrain from an inspection in respect of the matters
regulated by these Recommendations concerning the construction, installations and equipment of
vessels in so far as an attestation of a recognized Classification Society or of an appointed inland
vessels surveyor is available. The attestation shall not be older than six months.

2-7 UNIQUE EUROPEAN VESSEL IDENTIFICATION NUMBER

2-7.1 General
2-7.1.1 The competent authority issuing a certificate shall enter on that certificate the
European Identification Number. Unless the vessel possesses a European Identification Number
at the time of issue of the certificate it shall be assigned to that vessel by the competent authority
of the State in which the vessel has been registered or has its home port.
2-7.1.2 As far as the vessels from countries where an assignation of a European
Identification Number is not possible are concerned the European Identification Number to be
entered on the certificate shall be assigned by the competent authority issuing that certificate.
2-7.1.3 Only one single European Vessel Identification Number can be assigned to one
vessel. The European Identification Number is issued only once and remains unchanged
throughout the whole lifetime of the vessel.
2-7.1.4 The owner of a vessel, or their representative, shall be responsible for having the
European Identification Number which is entered in the certificate affixed to the vessel.
2-7.1.5 Each Member State shall notify the secretariat of UNECE of the competent
authorities responsible for assigning European Identification Numbers. The secretariat shall keep
a register of those competent authorities and of competent authorities notified by third countries,
and shall make the register available to the member States. On request this register shall also be
made available to competent authorities of third countries.
2-7.1.6 Each competent authority shall make all necessary arrangements in order to inform
all other competent authorities listed in the register of each European Identification Number it
assigns as well as of data for the identification of the vessel set out in 2-7.3. These data may be
made available to competent authorities of other States, as far as an equivalent level of privacy is
 ECE/TRANS/SC.3/172/Rev.1
page 13

guaranteed, on the basis of administrative agreements in order to perform administrative

measures for maintaining safety and ease of navigation.
2-7.2 European Vessel Identification Number
2-7.2.1 The identification number shall consist of eight Arabic numerals, as follows:
The first three digits shall indicate the competent authority of the State which assigned the
number. For this purpose the following key shall apply:
001–019 France
020–039 Netherlands
040–059 Germany
060–069 Belgium
070–079 Switzerland
080–099 Reserved for vessels from countries that are not party to the Mannheim
Convention and for which a Rhine Vessel certificate has been issued
before 01 April 2007
100–119 Norway
120–139 Denmark
140–159 United Kingdom of Great Britain and Northern Ireland
160–169 Iceland
170–179 Ireland
180–189 Portugal
190–199 Reserved
200–219 Luxembourg
220–239 Finland
240–259 Poland
260–269 Estonia
270–279 Lithuania
280–289 Latvia
290–299 Reserved
300–309 Austria
310–319 Liechtenstein
320–329 Czech Republic
330–339 Slovakia
340–349 Reserved
350–359 Croatia
360–369 Serbia
370–379 Bosnia and Herzegovina
380–399 Hungary
400–419 Russian Federation
420–439 Ukraine
440–449 Belarus
450–459 Republic of Moldova
460–469 Romania
470–479 Bulgaria
480–489 Georgia
490–499 Reserved
500–519 Turkey
ECE/TRANS/SC.3/172/Rev.1
page 14

520–539 Greece
540–549 Cyprus
550–559 Albania
560–569 The former Yugoslav Republic of Macedonia
570–579 Slovenia
580–589 Montenegro
590–599 Reserved
600–619 Italy
620–639 Spain
640–649 Andorra
650–659 Malta
660–669 Monaco
670–679 San Marino
680–699 Reserved
700–719 Sweden
720–739 Canada
740–759 United States of America
760–769 Israel
770–799 Reserved
800–809 Azerbaijan
810–819 Kazakhstan
820–829 Kyrgyzstan
830–839 Tajikistan
840–849 Turkmenistan
850–859 Uzbekistan
860–869 Iran
870–999 Reserved
2-7.2.2 The next five digits of the identification number shall indicate the serial number in
the register kept by the competent authority.
2-7.3 Data for the identification of a vessel
2-7.3.1 All vessels
1. Unique European Identification Number
2. Name of the vessel
3. Type of vessel as defined in Article 1–2
4. Length overall
5. Breadth overall
6. Draught as defined in Article 1–2
7. Source of data (ship’s certificate)
8. Deadweight for cargo vessels
9. Displacement for vessels other than cargo vessels
10. Operator (owner or their representative), if possible with regard to privacy
11. Issuing Authority
12. Number of ship’s certificate
13. Expiration date of ship’s certificate
14. Creator of dataset (in case of electronic databases)
 ECE/TRANS/SC.3/172/Rev.1
page 15

2-7.3.2 Where available

1. National number
2. Type of vessel in accordance with the International Standard for Notices to
Skippers and for Electronic Ship Reporting in Inland Navigation (Resolution
No. 60)
3. Single or double hull in accordance with ADN
4. Height as defined in Article 1–2
5. Gross tonnage (for sea-going ships)
6. IMO number (for sea-going ships)
7. Call sign (for sea-going ships)
8. MMSI (Maritime Mobile Service Identity) number
9. ATIS (Automatic Transmitter Identification System) code
10. Type, number, issuing authority and expiration date of other certificates
 ECE/TRANS/SC.3/172/Rev.1
page 17

CHAPTER 3
SHIPBUILDING REQUIREMENTS
3-1 STRENGTH
3-1.1 The general structural strength of the hull shall be sufficient to withstand all stresses
under normal conditions of operations.
3-1.2 The structure of the hull, superstructures, deckhouses, machinery casings,
companionways, hatchways and their closures, etc., and the equipment shall be designed to
withstand the normal conditions of operation to the satisfaction of the Administration. The
Administration may consider this requirement met by a vessel built and maintained in
conformity with the rules of a recognized Classification Society.
However the minimum thickness for bottom and side plating shall never be less then
3 mm.

3-2 STRUCTURAL REQUIREMENTS

3-2.1 Openings in decks
All removable covers shall be protected against accidental shifting. Access openings
shall be such as not to interfere with safe movement without prejudice to the requirements of
other safety regulations and, in particular, those of chapter 4, the coamings shall be as low as
possible. There shall be no possibility of covers and doors closing accidentally.
3-2.2 Hatchways
3-2.2.1 Construction of hatchways
Cargo hatchways shall be surrounded on all sides by coamings. It shall be made
impossible for loading tackle to catch on the lower edges of hold coamings.

3-3 STABILITY
3-3.1 General requirements
3-3.1.1 A vessel shall be designed and constructed to provide sufficient intact stability for all
anticipated service conditions.
3-3.1.2 A sufficient margin of stability shall be allowed for every stage of the voyage, taking
into account any increase in weight such as might result from the absorption of water by the cargo
or from icing, if the vessel is to operate under conditions where increases of this kind may occur.
3-3.1.3 The Administration may exempt a vessel from all stability checks provided that basic
stability data are available for a sister vessel and it is shown to the Administration's satisfaction
that all the stability information for that vessel can be validly used.
3-3.1.4 The Administration may consider the stability of the vessel as sufficient, if a stability
information has been approved by a recognized Classification Society.
ECE/TRANS/SC.3/172/Rev.1
page 18

3-3.2 Special requirements for vessels navigating in zone 1

3-3.2.1 Proof of sufficient stability shall be provided by calculation. In cases where the
Administration does not apply requirements of its own, a vessel may be considered as having
sufficient stability when it satisfies the criteria given in this chapter. Every vessel referred to in
paragraph 3-3.2.3 shall, on completion, undergo an inclining test in the presence of an expert of
the Administration to determine the displacement of the light vessel and the coordinates of its
centre of gravity.
3-3.2.2 In the calculations mentioned in paragraph 3-3.2.1, the adverse effects which the
carriage of certain bulk cargoes may have on stability shall be taken into account.
3-3.2.3 All new vessels and all vessels which have undergone conversions that may affect
their stability shall be furnished with approved information on their stability.
3-3.2.4 In the case of certain cargo vessels known to be stable, the stability information may
be based on calculations only, and an inclining test may be dispensed with.
3-3.2.5 The stability information referred to in paragraph 3-3.2.3 shall comprise:
the stability characteristics for typical loading conditions;
information in the form of tables or diagrams which will enable the boatmaster to
assess the stability of the vessel and verify whether it is sufficient in other loading conditions.
3-3.3 Special requirements for vessels navigating in zones 2 and 3
Vessels shall have sufficient stability. In cases where the Administration does not
apply stricter requirements of its own, a vessel may be considered as having sufficient stability
when it satisfies the criteria given in this chapter.

3-4 SUBDIVISION
3-4.1 Watertight bulkheads
3-4.1.1 Watertight bulkheads carried up to the uppermost continuous deck shall be fitted in
the places mentioned below.
3-4.1.2 A collision bulkhead shall be fitted at an appropriate distance from the forward
perpendicular. If the vessel has a long forecastle, the Administration may require the collision
bulkhead to be carried up to the forecastle deck.
3-4.1.3 In vessels navigating in zones 2 and 3 the collision bulkhead shall be between 0.04 L
and 0.04 L + 2 m. In vessels navigating in zone 1, the collision bulkhead shall be between 0.04
L and 0.08 L aft of the forward perpendicular, where L is the length defined in paragraph 1–2.
3-4.1.4 In vessels more than 25 m long, a bulkhead shall be fitted in the after part of the
vessel at an appropriate distance from the after perpendicular having regard to the configuration
of the vessels after extremity.
3-4.1.5 The accommodation, engine rooms and boilers, and the working spaces forming part
of these, shall be separated from the holds by watertight transverse bulkheads that extend up to
the deck.
 ECE/TRANS/SC.3/172/Rev.1
page 19

3-4.1.6 The Administration may require watertight bulkheads other than those mentioned
above in regard to the vessel's design.
3-4.1.7 The Administration may permit derogations from these provisions, provided that
equal safety is assured.
3-4.1.8 The bulkheads, the doors and closures in the bulkheads and the methods used for
testing them shall comply with the requirements of the Administration or of a recognized
Classification Society.
3-4.2 Openings in watertight bulkheads
3-4.2.1 General requirements applicable to all zones
3-4.2.1.1 No door or manhole shall be permitted in the collision bulkhead.
3-4.2.1.2 The number and dimensions of the openings in other watertight bulkheads shall be
reduced to the minimum compatible with the design and operation of the vessel; satisfactory
devices shall be provided for the watertight closing of these openings, with indicators showing
whether the devices are open or closed. It shall be possible to open and close doors on the spot
from either side of the bulkhead.
3-4.2.1.3 Where shafts, pipes, scuppers, electric cables, etc., are carried through watertight
subdivisions, arrangements shall be made to avoid impairing the watertight integrity of the
bulkheads or decks.
3-4.2.1.4 In the collision bulkhead, no valves or cocks shall be fitted which open directly into
the compartments lying abaft that bulkhead.
Such devices shall be avoided so far as possible in the other watertight bulkheads; if,
however, such devices are fitted, they shall at all times be capable of being opened and closed
from an accessible point situated above the uppermost continuous deck. Indicators shall be fitted
to show whether the devices are open or closed.
3-4.2.1.5 If the drainage pipes of the forepeak tank pass through the collision bulkhead, each
pipe shall be fitted with a valve which is controlled from a point situated above the freeboard
deck and which is fitted to the collision bulkhead inside the forepeak.
3-4.2.2 Special requirements for vessels navigating in zone 1
Doors in watertight bulkheads shall be provided with a system for watertight closing,
workable from either side of the bulkhead in proximity to the door and from a point above the
maximum draught level. Each door shall be fitted with indicators which show, at all operating
stations, whether it is open or closed.
In the accommodation and working spaces, however, and in the tweendeck
immediately below the freeboard deck, remote control shall not be required. The doors shall be
capable of being opened or closed on the spot from either side of the bulkhead. Hinged doors
may be allowed.
ECE/TRANS/SC.3/172/Rev.1
page 20

3-5 CRITERIA FOR CHECKING THE STABILITY OF VESSELS

3-5.1 General principles
3-5.1.1 The stability criteria do not take into account any shifting of cargo.
3-5.1.2 A vessel shall be deemed sufficiently stable if, for the loading conditions considered
in 3-5.1.6, it satisfies:
(i)The requirement that the initial metacentric height, corrected for the free-
surface effects of liquid cargo, should have a positive value;
(ii) Weather criteria, as determined in accordance with the requirements of section
3-5.2 below;
(iii) The requirements for stability, as determined in accordance with the
requirements of section 3-5.3 below with respect to the type and purpose of the
vessel.
3-5.1.3 The values for the moments of the external forces exerted on the vessel shall be taken
as constant for the whole range of inclination of the vessel.
3-5.1.4 The permissible heeling moment for all required loading conditions shall be
determined by means of a static or a dynamic stability curve in accordance with the values of
permissible angle of heel given for the various stability criteria in sections 3-5.2 and 3-5.3 below.
For vertical-sided vessels, the maximum permissible heeling moments may be
determined without constructing a curve, on the basis of the following formulae:
(i) For the dynamic effect of the external forces:
M perm = 0.0856 ⋅ Δ ⋅ GM 0 ⋅ ϕ perm ( kNm )

(ii) For the static effect of the external forces:

M perm = 0.1712 ⋅ Δ ⋅ GM 0 ⋅ ϕ perm (kNm ) .

where:
GM 0 = initial metacentric height corrected for the free-surface effects of liquid
cargo, in metres;
M perm
= permissible heeling moment.
3-5.1.5 The free-surface effects of liquid cargo shall be taken into account in the calculation
of stability.
For liquid cargo in tanks where the quantity of liquid changes during the operation of
the vessel, the calculation shall be made with the tanks filled to 50 % of their capacity.
A tank filled with liquid cargo to more than 95 % of its capacity shall be deemed
completely full.
In calculating the stability of a vessel, the liquid cargo residues commonly found up
to a depth of 5 cm in evacuated tanks shall not be taken into account.
If the vessel is intended for the transport of various types of liquid cargo, the
calculation shall assume the most unfavourable loading condition.
 ECE/TRANS/SC.3/172/Rev.1
page 21

3-5.1.6 The stability of vessels, other than passenger vessels, should be checked for the
following most unfavourable loading conditions:
(i) With 10 % stores, with no cargo;
(ii) With 100 % stores and 100 % cargo.
If the vessel carries solid ballast, its mass shall be included as part of the light
weight.
For all loading conditions, the inclusion of liquid ballast as part of the load should be
agreed with the Administration.
3-5.2 Weather criteria
3-5.2.1 The vessel shall satisfy the weather criterion if, under the most unfavourable loading
condition, the permissible moment produced by dynamic inclinations of the vessel is equal to or
greater than the heeling moment resulting from the dynamic pressure of the wind, i.e. if the
following condition is met: M perm ≥ M wd

where: M perm = permissible moment produced by the dynamic inclinations of the vessel
corresponding to the critical angle or to the capsizing angle, if the latter is
smaller;
M wd = heeling moment resulting from the dynamic pressure of wind, as in
3-5.2.3.
3-5.2.2 Certain types or individual vessels need not be checked for stability with respect to
the weather criterion if the competent authorities are satisfied beyond doubt that the stability
requirements are met by the said vessels in any case.
3-5.2.3 The heeling moment resulting from the dynamic pressure of the wind shall be taken
as: M wd = 0.001⋅ Pwd ⋅ Aw ⋅ l w (kNm)

where: Pwd = specific wind pressure, whose value shall be taken from the following table
for the navigation zone of the vessel and for the lever arm;
lw = lever arm of free-floating vessel = distance between the centre of gravity of
the lateral area and the plane of the load waterline considered, when the
vessel is upright in calm water (m).
Specific wind pressure Pwd (Pa):
OZ P 
     
1DYLJDWLRQ]RQH
      
      

The lateral plane above water Aw should include all above-water projected surfaces
(hull, superstructure, deck machinery, deck cargo, and other elements of the above-water part of
the vessel) at the centre of the vessel when it is upright. The projected areas of structures of
ECE/TRANS/SC.3/172/Rev.1
page 22

round section located separately on the 7\SHRIODWWLFHVWUXFWXUH &RHIILFLHQWRIIXOOQHVV

deck should be assumed to have an /LIHUDLOV 
effective coefficient of flow of 0.6.
ZLWKRXWJXDUGPHVK 
The lateral area of lattice- ZLWKJXDUGPHVK 
type structures above the waterline shall 2WKHUODWWLFHVWUXFWXUHV ±
be calculated on the basis of the areas
bounded by these structures multiplied by the coefficients of fullness taken from the following
table:
3-5.3 Stability requirements for different types of ships
3-5.3.1 Passenger vessels shall comply with the requirements of section 15-3.
3-5.3.2 Cargo vessels
3-5.3.2.1 The stability of cargo vessels carrying deck cargo or cargo in holds, where the centre
of gravity of the lateral area of the vessel and cargo is more than 2 m above the load waterline
considered, should satisfy the supplementary requirement laid down in 3-5.3.2.2.

3-5.3.2.2 The heeling moment of a vessel resulting from the static effect of wind M wst should
not exceed the maximum permissible moment produced by the static inclinations of the vessel
M perm , i.e., the following condition should be met:
M perm ≥ M wst

where: M perm = maximum permissible moment produced by the static inclinations of the
vessel = moment corresponding to an angle of heel representing 80 % of
the critical angle;
M wst = as in 15-3.5.

3-5.3.2.3 All vessels for which the ratio of the total power of the main machinery N e to the
maximum permissible displacement Δ is Ne /ǻ > 0.75 kW/t shall be checked with respect to the
turning criterion as in 15-3.6. Their angle of heel should not in this case exceed 80 % of the
critical angle.
3-5.3.3 Tugs
3-5.3.3.1 Tugs shall have sufficient stability if the maximum permissible moment of the vessel
M perm (see 3-5.2.1) is greater than or equal to the sum of the heeling moments resulting from the
dynamic effect of wind M wd (see 3-5.2.3) and the dynamic effect of the lateral component of the
bollard pull force M t (see 3-5.3.3.2), i.e., if the following condition is met:
M perm ≥ M wd + M t

3-5.3.3.2 The heeling moment resulting from the dynamic pressure of the lateral component of
the bollard pull force shall be determined by the formula:
M t = 1.1 ⋅ TB ⋅ ( zt − T )
 ECE/TRANS/SC.3/172/Rev.1
page 23

where: zt = height of the point of application of the bollard pull force above the base
line (m);
TB = maximum bollard pull force measured on checking at moorings (kN).

In cases where TB is not known, the following values shall be assumed for
calculation purposes:
For Δ ” 30 t:
TB = 0.13 N e - for tugs without propeller nozzles;

TB = 0.20 N e - for tugs with propeller nozzles;

For Δ • 30 t:
TB = 0.16 N e - for tugs without propeller nozzles;

TB = 0.20 N e - for tugs with propeller nozzles:

where Ne = the total power of the main machinery (kW).

3-5.3.3.3 In addition to the conditions laid down in 3-5.3.3.1, the stability of each tug should
satisfy the following supplementary requirement:
the angle of heel resulting from the combined effect of the heeling moments
produced by the dynamic pressure of wind M wd and the effect of the centrifugal
force on turning M cf (see 15-3.6) should not exceed the critical angle and should in
no case exceed 15°.
3-5.4 Supplementary requirements for vessels in navigation zone 1
3-5.4.1 General provisions
3-5.4.1.1 The stability of vessels intended for navigation in zone 1 should satisfy the
requirements of sections 3-5.1, 3-5.2 and 3-5.3 for vessels of zone 2, and also the supplementary
requirements of this section. Furthermore, the conditions for satisfactory stability laid down in
paragraph 3-5.1.2, subparagraphs (i) and (ii) should also be met for the simultaneous rolling of
the vessel.
3-5.4.1.2 Compliance with the applicable requirements of the IMO Recommendations for sea-
going ships may be considered as equivalent to compliance with these Recommendations.
3-5.4.1.3 When checking stability with respect to the weather criterion, the heeling moment
resulting from the dynamic pressure of wind M wd shall be calculated taking the specific wind
pressure Pwd for navigation zone 2, as in the table at paragraph 3-5.2.3.

3-5.4.1.4 The permissible heeling moment M perm shall be determined by means of the stability
curve, taking into account the value for the amplitude of roll calculated as in 3-5.4.2.
ECE/TRANS/SC.3/172/Rev.1
page 24

3-5.4.1.5 The critical angle shall be taken to be the angle of heel at which water begins to fill
the vessel through unsecured openings in the side plating or on the deck. The maximum angle
may not extend further than the upper edge of the side coaming of the cargo hatch or the upper
edge of the expansion trunks of tankers.
3-5.4.2 Calculation of the value for the amplitude of roll of a vessel

3-5.4.2.1 The value for the amplitude of roll ϕ m of a flat-bottomed vessel with a bilge radius of
0.05 B or more not fitted with bilge keels shall be determined from the following table in terms
of a value m calculated by the formula:
m = 0.66 ⋅ m1 ⋅ m 2 ( s −1 )

where m1 and m2 = factors determined in accordance with paragraphs 3-5.4.2.2 and 3-5.4.2.3.

m V        RUPRUH

ϕm R        

3-5.4.2.2 The factor m1 shall be calculated by the formula:

mo
m1 = ( s −1 )
GM
where: GM = initial metacentric height for the loading condition considered,
without correction for the free-surface effects of liquid cargo;
m0 = a value from the following table in relation to B ⋅ GM
the parameter n1 determined by the formula: n1 =
KG ⋅ 3 Δ
where: KG = see paragraph 15-3.6.

 n1  RU         RU
OHVV PRUH
 m0           

3-5.4.2.3 The non-dimensional factor m2 shall be taken from the following table as a function
of the ration B / T .

B /T  RU         RU
OHVV PRUH
m2           

3-5.4.2.4 In cases where the bilge radius is less than 0.05 B , the value for the amplitude of roll
determined in accordance with paragraph 3-5.4.2.1 may be reduced to a value of ϕ determined
5r
by the formula: ϕ = ϕ m ⋅ (0.75 + ) ( degrees )
B
where: r = bilge radius (m).
 ECE/TRANS/SC.3/172/Rev.1
page 25

3-5.4.2.5 The amplitude of roll ϕ m determined in accordance with paragraph 3-5.4.2.1 shall be
taken into account in the stability curve (see sketches 3-5.4.2.5.1 (a) and (b) and 3-5.4.2.5.2 (a)
and (b)).
M

B
GM.
C A E
Mperm
0 57,3 o
ϕperm ϕ
o

ϕm 3-5.4.2.5.1 (a)

W
W'

Mperm
o
O' ϕ'
ϕm 0 57,3 o ϕperm ϕ
o

3-5.4.2.5.2 (a)

Explanation of sketches 3-5.4.2.5.1 (a) and (b) and 3-5.4.2.5.2 (a) and (b)
Sketches 3-5.4.2.5.1 (a) and 3-5.4.2.5.1 (b) show static stability curves constructed taking into
account the amplitude of roll ϕ m in the following manner:

the curves are amplified by a static stability curve in the area of negative angles of
heel to the abscissa ϕ m (segment O-D);

in order to determine the maximum heeling moment, the area on the static stability
diagram below the curve up to angle ϕ perm (ABE) should be equal to the area above
the curve (ACD);
ECE/TRANS/SC.3/172/Rev.1
page 26

B
GM .
C A
E
Mperm
o
ϕ
o
0 57,3
D
ϕperm
ϕm 3-5.4.2.5.1 (b)
The diagram in sketch 3-5.4.2.5.1 (a) shows a case in which the angle ϕperm equals the
capsizing angle, and the diagram in sketch 3-5.4.2.5.1 (b) a case in which the angle ϕperm
equals the angle of maximum heel which is permissible on other grounds.

W'

Mperm

ϕ'
o
O' ϕperm
0
ϕm ϕ
o

57,3o
3-5.4.2.5.2 (b)
Sketches 3-5.4.2.5.2 (a) and 3-5.4.2.5.2 (b) show static stability curves constructed taking into
account the amplitude of roll ϕm in the following manner:
The curves are amplified by a dynamic stability curve in the area of negative angles
of heel to the abscissa ϕm;
A tangent to the dynamic stability curve is produced through new origin O' in order
to determine the maximum capsizing moment ϕperm (cf. sketch 3-5.4.2.5.2 (a)), or a
straight line is produced through the point of intersection of the dynamic stability
curve with a vertical straight line drawn from the point of the angle of heel ϕperm
which is permissible on other grounds;
The segment at an angle of 1 radian gives the value of the maximum permissible
heeling moment.
 ECE/TRANS/SC.3/172/Rev.1
page 27

CHAPTER 3A
FIRE PROTECTION
3A-1 STRUCTURAL REQUIREMENTS
3A-1.1 The hull, superstructures, structural bulkheads, decks and deckhouses shall be made
of steel. The Administration or a recognized Classification Society may allow the use of other
materials with due regard to the risk of fire.
On vessels with a length of 85 m or more and intended for navigation in zone 1, in
accommodation spaces, the corridor bulkheads shall be made of steel or other materials approved
by the Administration or recognized Classification Society with due regard to the risk of fire.
3A-1.2 Crew elevator trunks within accommodation and interior stairways below the open
deck shall be made of steel or equivalent material.
3A-1.3 The bulkheads of galleys, paint stores, lamprooms, boatswain's stores (when adjacent
to accommodation spaces) and emergency generator rooms, if any, shall be made of steel or
equivalent material.
3A-1.4 Deck, bulkhead and ceiling coverings within accommodation spaces shall be made of
flame-retardant materials. They shall be made of fire resistant materials when they form part of
an escape route or a partition between the accommodation space and machinery spaces or store
rooms. The furniture in the above-mentioned accommodation spaces shall be made of a material
which will not easily catch fire. In the case of fire or heating the materials shall not release toxic
or explosive gases in dangerous concentrations.
3A-1.5 Bulkheads, ceilings and doors of machinery spaces and boiler rooms shall be made
of steel or other equally fire-resistant material.
Stairways and ladders leading to machinery spaces and boiler rooms shall be fixed
permanently and made of steel or equivalent material.
3A-1.6 Paints, varnishes and similar products having a nitro-cellulose or other highly
inflammable base shall not be used for the interior furnishings in a vessel’s spaces.
3A-1.7 Tanks and their pipelines as well as other accessories shall be laid out and arranged
with due regard to the risk of fire and in such a way that no fuel or gas can escape accidentally
into the vessel. Tank valves intended for fuel sampling or water drainage shall close
automatically. Materials with a low resistance to heat shall not be used for overboard scuppers,
sanitary discharges or other outlets which are close to the water line, or in places where failure of
the material in the event of fire might cause flooding.
3A-1.8 At tank outlets the pipelines for the distribution of liquid fuels shall be fitted with a
shutoff device that can be operated from the deck.
3A-1.9 Electric radiators shall be so designed and fixed in position as to reduce fire risks to a
minimum.
3A-1.10 Forced ventilation of machinery spaces shall be capable of being stopped from an
easily accessible position outside the machinery spaces.
ECE/TRANS/SC.3/172/Rev.1
page 28

3A-1.11 Automatic devices for detecting and signalling about smoke or heat, which indicate
fire on board, shall satisfy the requirements of the Administration or recognized Classification
Society.

3A-2 MEANS OF ESCAPE

3A-2.1 In all crew spaces and spaces in which crew members are normally employed,
stairways and ladders shall be so installed as to provide a ready means of escape to an open deck.
3A-2.2 Living and sleeping quarters shall have at least two exits as far apart from each other
as possible which serve as escape routes. One of them may be designed as an emergency exit.
This does not apply to areas with an exit giving directly onto the deck or into a corridor which
serves as an escape route, provided the corridor has two exits at a distance from each other and
giving onto port and starboard. Emergency exits, which may include skylights and windows,
shall have a clear opening of at least 0.36 m² with a smallest side of at least 0.50 m and permit
rapid evacuation in an emergency.
3A-2.3 Engine and boiler rooms shall have two exits of which one may be an emergency
exit.
The second exit may be dispensed with if:
(i) The total floor area (average length x average width) of the engine or boiler
room does not exceed 35 m2; and
(ii) The distance between each point where service or maintenance operations are
to be carried out and the exit, or foot of the stairway near the exit providing
access to the outside, is not longer than 5 m; and
(iii) A fire extinguisher is placed at the maintenance station that is furthest removed
from the exit door.

3A-3 STORAGE OF FLAMMABLE LIQUIDS

To store flammable liquids with a flash point of less than 55ºC there shall be a
ventilated cupboard made of non-combustible material on deck. On its outside there shall be a
symbol “No naked lights or fires and no smoking” in accordance with sketch 2 of appendix 3 and
with a diameter of at least 10 cm.
 ECE/TRANS/SC.3/172/Rev.1
page 29

CHAPTER 4
SAFETY CLEARANCE, FREEBOARD AND DRAUGHT MARKS
4-1 GENERAL
4-1.1 This chapter specifies the minimum freeboard for inland waterway vessels. It also
contains requirements concerning the indication of the freeboard mark.
4-1.2 This chapter assumes that the nature and stowage of the cargo, ballast, etc., are such
as to ensure adequate stability and as to obviate any excessive structural fatigue.
4-1.3 Freeboards as prescribed in this chapter shall be assigned on the assumption, first,
that navigation will cease when weather conditions are such that the maximum wave height
defining the zone or zones in which a vessel is to navigate may be exceeded, and second that in
such conditions vessels already under way will seek shelter as quickly as possible.
4-1.4 The Administration may consider it sufficient if the vessel has been built and
maintained in conformity with the rules of a recognized Classification Society.

4-2 TYPES OF VESSELS

For the purpose of this chapter, vessels shall be divided into three types:
Type A – Decked vessels
Type B – Tankers
Type C – Open vessels
Type A: Decked vessels: Decked vessels are vessels whose hatch covers are satisfactorily
strong, rigid, watertight for zone 1 and sprayproof for zones 2 and 3.
Type B: Tankers and similar vessels: These vessels have only small openings giving access
to the tanks, the openings being closed by steel or equivalent covers with watertight fittings.
Such vessels have the following characteristics:
(i) Very high watertight integrity of the exposed deck;
(ii) Very high resistance to flooding, through low permeability of the loaded
compartments and through the degree of subdivision applied in general.
Type C: Open vessels: Open vessels are either vessels whose hatch covers are not
satisfactorily strong, rigid, sprayproof or vessels whose cargo hatchways are open.

4-3 APPLICATION AND DEROGATIONS

4-3.1 The maximum draught level shall be so determined that both the freeboard
requirements and the safety-distance requirements are observed. For safety reasons, however,
the Administration may prescribe a higher figure for the freeboard.
4-3.2 Vessels so constructed that application of the provisions of this chapter is
unwarranted or impracticable shall be assigned freeboards by the Administration in such a way
that the safety conditions are equivalent to those of this chapter.
ECE/TRANS/SC.3/172/Rev.1
page 30

4-3.3 In the case of zone 1, derogations from the conditions of assignment of freeboard
may be allowed to vessels to which a freeboard in excess of the minimum freeboard is assigned,
provided that the safety conditions are deemed satisfactory by the Administration.

4-4 DETERMINATION OF FREEBOARDS

4-4.1 General
4-4.1.1 Deck line
The deck line is the upper edge of a horizontal rectangle 300 mm long and 25 mm
wide. This rectangle shall be marked amidships on each side of the hull, and its upper edge shall
normally pass through the point where the continuation outwards of the upper surface of the
freeboard deck intersects the outer surface of the shell amidships. However, the deck line may
also be marked at a different height provided that the freeboard is corrected accordingly.
4-4.1.2 Freeboard mark
The freeboard mark for vessels for zone 3 consists of a horizontal band of 300 mm
long and 40 mm width.
The freeboard mark for zones 1 and 2 shall consist of a ring intersected through its
centre by a horizontal line which shall be supplemented if necessary by additional freeboard
lines.
The width of the ring and of all the other lines of the freeboard mark shall be 30 mm;
the outer diameter of the ring shall be 200 mm; the length of the horizontal line intersecting the
ring shall be 300 mm; and the size of the numerals designating the zones shall be 60 x 40 mm
(Figure 1). 30
200

30

30

Figure 1
300 150

Zones 1 and 2

3 3 3

2 2

1
Zone 3 Zone 2 Zone 1
 ECE/TRANS/SC.3/172/Rev.1
page 31

The centre of the ring shall be placed amidships. The lower edge of the horizontal
line which intersects the ring shall pass through the centre of the ring and shall constitute the
freeboard line.
If the vessel is intended to navigate in several navigation zones, a vertical line and
additional freeboard lines 150 mm in length shall be applied forward of the centre of the ring.
The lower edge of each freeboard line shall correspond to the freeboard prescribed
for the navigation zone concerned.
If the vessel is measured in accordance with the Convention on the Measurement of
Inland Navigation Vessels, it shall bear, in addition to the freeboard mark, a measurement mark
in accordance with the requirements of this Convention.
The freeboard mark and the measurement mark may be combined. In this case, the
width of the freeboard mark rectangle (the width of the upper line if there are a number of
freeboard marks) should be 40 mm.
4-4.2 Minimum freeboard in zones 1 and 2
4-4.2.1 Minimum freeboard (F) for vessels of type A

0LQLPXPIUHHERDUG ) PP
/HQJWKRIWKHYHVVHOP
=RQH =RQH
≤  
  
  
  
  
≥  
1RWH,QWKLVDQGDOOVXEVHTXHQWWDEOHVWKHYDOXHVIRUWKHLQWHUPHGLDWHOHQJWKVRIYHVVHOVVKDOO
EHREWDLQHGE\OLQHDULQWHUSRODWLRQ

4-4.2.2 Minimum freeboard (F) for vessels of type B

0LQLPXPIUHHERDUG ) PP
/HQJWKRIWKHYHVVHOP
=RQH =RQH
≤  
  
  
  
  
≥  

4-4.2.3 The minimum freeboard of flush-deck vessels should be obtained in the manner
indicated for the vessel of type B.
4-4.2.4 The minimum freeboard for vessels of type C, regardless of length, should be not
less than:
ECE/TRANS/SC.3/172/Rev.1
page 32

for zone 1 – 1 000 mm

zone 2 – 600 mm.
Furthermore, the sum of the freeboard and the height of coamings for these vessels
must be not less than:
for zone 1 – 1 200 mm
zone 2 – 1 000 mm.
4-4.2.5 The Administration may authorize corrections for the freeboard for vessels with
poop, sheer and forecastle, providing that such corrections are calculated in conformity with the
rules of the Administration or of a recognized Classification Society.
4-4.3 Arrangement of openings and coamings
4-4.3.1 All outside doors of superstructure, deckhouses and companionways, situated on the
freeboard deck shall be watertight on vessels in zone 1 and sprayproof on vessels in zones 2 and 3.
4-4.3.2 The coamings of hatchways, companionways and access openings to superstructures
shall be not less than 300 mm high on vessels in zone 1 and 150 mm on vessels in zone 2.
4-4.3.3 If the height of the coamings is less than that required by this chapter, the minimum
freeboard height shall be increased by the difference between the height required in 4-4.3.2 and
the actual height of the coamings.
4-4.3.4 The freeboard height may not be reduced owing to an increase in the height of
coamings below the figure indicated in 4-4.3.2.
4-4.3.5 Exposed cargo hatchways and other hatchways on the freeboard deck shall be fitted
with watertight closures on vessels in zone 1 and sprayproof closures on vessels in zones 2 and 3.
4-4.3.6 Ventilator heads on the exposed parts of the freeboard deck shall be fitted with a
strong steel coaming of a height not less than that required for hatchway coamings. Ventilator
heads for vessels in zone 1 must have watertight closures.
4-4.3.7 Pipe outlets in the ship’s sides below the freeboard deck shall be fitted with efficient
and accessible devices to prevent water from entering the vessel.
4-4.3.8 On vessels in zone 1, side scuttles in spaces below the freeboard deck, windows in
superstructures, deckhouses and companionways and windows in skylights on the freeboard
deck shall be watertight. In addition, side scuttles in spaces below the freeboard deck shall be
provided with permanently attached deadlights. The distance between side scuttles in the shell
and the maximum draught level shall not be less than 300 mm.
4-4.3.9 Skylights and windows must be of sturdy construction
4-4.3.10 On vessels in zones 2, skylights and windows must be fitted with sprayproof covers
which shall be permanently attached if the lowest part of the openings falls within the safety
clearance prescribed for the coamings of uncovered holds (para. 4-4.3.11). In this case, the
height ( h ) of the superstructures in which the openings are provided is limited to the lowest
point of these openings.
 ECE/TRANS/SC.3/172/Rev.1
page 33

4-4.3.11 For vessels of type A and type B, the safety clearance as defined in 1-2 must not be
less than 600 mm for zone 2.
For vessels of type C, as well as other vessels navigating with open holds, this
distance shall be increased to 400 mm in zone 2. However, this increase applies only to the
coamings of open holds.
4-4.3.12 The covers of Kingston valves and ice boxes must be watertight.
4-4.3.13 The scuppers and freeing ports in bulwarks shall be of sufficient size to drain the
decks of shipped water.
4-4.4 Special requirements for freeboard in zone 3
4-4.4.1 For vessels of types A and B, the safety clearance must not be less than 300 mm.
4-4.4.2 For vessels of the type C, the safety clearance must not be less than 500 mm.
4-4.4.3 The basic freeboard of vessels with a continuous deck without superstructures and
sheer shall be 150 mm.
4-4.4.4 The Administration may authorize a correction for the freeboard for vessels with
superstructures and sheer providing that such correction is calculated in conformity with the
rules of the Administration or of a recognized Classification Society.
In view of the reduction referred to above the minimum freeboard shall not be less
then 0 mm.
 ECE/TRANS/SC.3/172/Rev.1
page 35

CHAPTER 5
MANOEUVRABILITY
5-1 GENERAL
5-1.1 Vessels and convoys shall display adequate navigability and manoeuvrability.
5-1.2 Powered vessels and convoys shall meet the requirements set out in appendix 4.

5-2 NAVIGATION TESTS

5-2.1 Navigability and manoeuvrability shall be checked by means of navigation tests.
The following, in particular, shall be examined in accordance with the requirements of one of the
alternatives as set out in appendix 4:
Speed (forward);
Stopping capacity;
Capacity for going astern;
Capacity for changing course;
Turning capacity.
5-2.2 The competent authority on the inspection of vessels; shall enter into the ship’s
certificate under number 52, which of the alternatives as set out in appendix 4 has been applied
for the navigation tests.
5-2.3 The Basin administration may dispense with all or part of the tests where compliance
with the navigability and manoeuvrability requirements is proven in another manner.

5-3 TEST AREA

5-3.1 The navigation tests referred to in paragraph 5-2 shall be carried out on areas of
inland waterways that have been designated by a competent authority.
5-3.2 Those test areas shall be situated on a stretch of running or still water that is if
possible straight, at least 2 km long and sufficiently wide and is equipped with highly-distinctive
marks for determining the position of the vessel.
5-3.3 It shall be possible for the competent authority on the inspection of vessels to plot the
hydrological data such as depth of water, width of navigable channel and average speed of the
current in the test area as a function of the water level.

5-4 LOADING OF VESSELS AND CONVOYS DURING NAVIGATION TESTS

During navigation tests, vessels and convoys intended to carry goods shall be loaded
in accordance with the requirements of the Basin administration.

5-5 USE OF ON-BOARD FACILITIES FOR NAVIGATION TEST

5-5.1 During the navigation test, all of the equipment providing the manoeuvrability of the
vessel which may be actuated from the wheelhouse may be used, apart from any anchor.
5-5.2 However, during the test involving turning into the current referred to in paragraph
5-10, the anchors may be used.
ECE/TRANS/SC.3/172/Rev.1
page 36

5-6 SPEED (FORWARD)

5-6.1 Vessels and convoys shall achieve at least the required speed in relation to the water
according to the requirements of one of the alternatives as set out in appendix 4. In any case,
such speed should not be less than 12 km/h. 2
5-6.2 The competent authority on the inspection of vessels may grant exemptions to
vessels and convoys operating solely in estuaries and ports.
5-6.3 The competent authority on the inspection of vessels shall check whether the vessel
sailing light has the capacity to exceed a speed of 40 km/h relative to the water. If so, the
following particular shall be entered in the ship’s certificate: “The vessel has the capacity to
exceed a speed of 40 km/h relative to the water.”

5-7 STOPPING CAPACITY

5-7.1 Vessels and convoys shall be able to stop in good time and within the limits of the
minimum required distance while remaining adequately manoeuvrable.
5-7.2 Where vessels and convoys are not longer than 86 m and not wider than 22.9 m, the
Basin Administration may replace the stopping capacity mentioned above by turning capacity
against the current.

5-8 CAPACITY FOR GOING ASTERN

5-8.1 Vessels and convoys are to have sufficient capacity for going astern, which has to be
checked during the tests.
5-8.2 Where the stopping manoeuvre required by paragraph 5-7 is carried out in still water
it shall be followed by a test while going astern.

5-9 CAPACITY FOR CHANGING COURSE

Vessels and convoys shall be able to change course in good time. That capacity shall
be proven by means of manoeuvres carried out within a test area as referred to in paragraph 5-3.

5-10 TURNING CAPACITY

The turning capacity shall be examined in accordance with the requirements of one
of the alternatives as set out in appendix 4.


2
Administration may assign to vessels and convoys operating exclusively within a particular river basin, a
minimum speed that differs from the value prescribed in this paragraph, taking into account local conditions and
manoeuvrability of the vessels/convoys.
 ECE/TRANS/SC.3/172/Rev.1
page 37

CHAPTER 6
STEERING GEAR
6-1 GENERAL REQUIREMENTS
6-1.1 Vessels shall be equipped with steering gear which ensures at least the
manoeuvrability prescribed in chapter 5.
6-1.2 The steering gear shall be so constituted that the rudder position cannot change
unexpectedly.
6-1.3 The entire steering gear shall be designed for a permanent list up to 15°, an angle of
trim up to 5° and ambient temperatures from -20° C to + 40° C.
6-1.4 The component parts of the steering gear shall be rugged enough always to be able to
withstand the stresses to which they may be subjected during normal operation. No external
forces applied to the rudder shall impair the operating capacity of the steering equipment and its
controls.
6-1.5 The steering gear shall comprise a power-driven unit if the forces required to activate
the rudder require so.
6-1.6 The power-driven unit of the steering gear shall be protected against overload.
6-1.7 The penetrations for the rudder stocks shall be so designed as to prevent the spread of
water-polluting lubricants.

6-2 STEERING APPARATUS CONTROL UNIT

6-2.1 If the steering gear has a power-driven unit, in case of the failure or breakdown of the
steering apparatus control unit, it shall be possible to bring a second unit or a manual drive into
service within five seconds.
6-2.2 If the second steering apparatus control unit or manual drive is not automatically
brought into service, it shall be possible for the helmsman to bring it into service simply and
rapidly by means of a single manipulation.
6-2.3 The second drive unit or manual drive shall ensure the manoeuvrability prescribed in
chapter 5.

6-3 HYDRAULIC DRIVE UNIT

6-3.1 No consumer appliance may be connected to the hydraulic drive unit of the steering
gear.
6-3.2 If there are two hydraulic drive units, a hydraulic tank is required for each of them;
double tanks, however, are permitted. The hydraulic tanks shall be equipped with an oil low-
level indicator with alarm.
6-3.3 The dimensions, construction and arrangement of the piping shall ensure, as far as
possible, that they will not be damaged by mechanical effects or fire.
ECE/TRANS/SC.3/172/Rev.1
page 38

6-3.4 Hoses are only permitted when their use is indispensable to absorb vibrations and
permit the freedom of movement of the constituent parts. They shall be rated at least according
to the maximum working pressure.
6-4 POWER SOURCE
6-4.1 If the steering gear is equipped with two power-driven units, it shall have two power
sources.
6-4.2 If the second power source for the power-driven unit is not permanently available
while the vessel is under way, a buffer device is required. Its capacity shall be sufficient to
provide power during the period needed for bringing the second power source into operation.
6-4.3 In the case of electrical power sources, no other consumers may be powered by the
network supplying the steering gear.
6-5 MANUAL DRIVE
6-5.1 The hand wheel shall not be actuated by the power-driven unit.
6-5.2 Regardless of rudder position hand wheel kickback must be prevented when the
manually-operated wheel is engaged automatically.
6-6 RUDDER-PROPELLER, WATER-JET, CYCLOIDAL-PROPELLER, AND
ACTIVE BOW-RUDDER SYSTEMS
6-6.1 In the case of rudder-propeller, water-jet, cycloidal-propeller or active bow-rudder
installations where the remote control of the modification of the direction of the drive is electric,
hydraulic or pneumatic, there shall be two steering apparatus control units independent of each
other, between the wheelhouse and the installation, and on analogy, meet the requirements of
paragraphs 6-1 to 6-5.
Such systems are not subject to this section, if they are not necessary in order to
achieve the manoeuvrability required by chapter 5 or if they are only needed for the stopping
test.
6-6.2 Where there are several rudder-propeller, water-jet, cycloidal-propeller or bow-
rudder systems that are independent of each other, the second steering apparatus control unit is
not necessary if the vessel retains the manoeuvrability required by chapter 5 if one of the units
fails.

6-7 INDICATORS AND MONITORING DEVICES

6-7.1 The rudder position shall be clearly displayed at the steering position. If the rudder-
position indicator is electrical, it shall have its own power supply.
6-7.2 There shall be at least the following indicators or monitoring devices at the steering
position:
(i) Oil level in the hydraulic tanks in accordance with paragraph 6-3.2, and
working pressure of the hydraulic system;
(ii) Failure of the electrical supply for the steering control;
(iii) Failure of the electrical supply for the drive unit;
 ECE/TRANS/SC.3/172/Rev.1
page 39

(iv) Failure of the rate-of-turn regulator;

(v) Failure of the required buffer devices.

6-8 RATE-OF-TURN REGULATORS

6-8.1 The rate-of-turn regulators and their components shall meet the requirements laid
down in paragraph 9-2.18.
6-8.2 The proper functioning of the rate-of-turn regulator shall be displayed at the steering
position by means of a green warning light.
Any lack of or unacceptable variations in the supply voltage and an unacceptable fall
in the speed of rotation of the gyroscope shall be monitored.
6-8.3 Where, in addition to the rate-of-turn regulator, there are other steering control
systems, it shall be possible to distinguish clearly at the steering position which of these systems
has been activated. It shall be possible to shift from one system to another immediately. The
rate-of-turn regulator shall not cause any kickback in the steering systems.
6-8.4 The electrical supply to the rate-of-turn regulator shall be independent of that for the
other power consumers.
6-8.5 The gyroscopes, detectors and rate-of-turn indicators used in the rate-of-turn
regulators shall meet the minimum requirements and test conditions concerning rate-of-turn
indicators for inland waterways as set by the competent authority.

6-9 APPROVAL
6-9.1 The compliance of the installed steering system shall be checked by a competent
authority on the inspection of vessels. It may, for this purpose, request the following documents:
(i) Description of the steering gear;
(ii) Drawings and information on the steering apparatus control units;
(iii) Information concerning the steering apparatus;
(iv) Electrical wiring diagram;
(v) Description of the rate-of-turn regulator;
(vi) System-use instructions.
6-9.2 Operation of the entire steering gear shall be checked by means of a navigation test.
It shall be checked that a predetermined course can be reliably maintained by the rate-of-turn
regulators and that bends can be negotiated safely.
 ECE/TRANS/SC.3/172/Rev.1
page 41

CHAPTER 7
WHEELHOUSE
7-1 GENERAL REQUIREMENTS
7-1.1 It shall be possible to control and monitor propelling machinery and steering gear
from the steering station. Propelling machinery fitted with a clutch which can be operated from
the steering station or actuating a rudder propeller which can be operated from the steering
station may be started and stopped only from the engine room.
7-1.2 Every engine shall be controlled by a single lever moving through the arc of a circle
in a vertical plane more or less parallel to the longitudinal axis of the vessel. Forward movement
of the lever shall cause the vessel to move forward and movement of the lever towards the stern
shall cause the vessel to move astern. Engaging and reversing the engine shall be carried out by
the lever. The neutral position of the lever shall be indicated by a perceptibly distinguishable
click or by a perceptibly distinguishable marking. The sweep of the lever from the neutral
position to the “full speed ahead” position and from the neutral position to the “full speed astern”
position shall not exceed 90°.
7-1.3 The wheelhouse shall be equipped with adjustable heating and ventilation systems.
The wheelhouse darkening device shall not interfere with ventilation.
7-1.4 The glazing used in wheelhouses shall display a light transmission of at least 75 %.
7-1.5 Under normal operating conditions, the sound-pressure level of the noise produced
by the vessel shall not exceed 70 dB(A) at the helmsman’s head position. However, the
Administration may authorize a sound-pressure level of 75 dB(A) at the helmsman’s head
position for vessels not more than 30 m in length, with the exception of pushers.
7-1.6 Tell-tale lamps or any other equivalent device for monitoring the signal lights shall
be installed in the wheelhouse unless that monitoring can be performed direct from the
wheelhouse.

7-2 UNOBSTRUCTED VIEW

7-2.1 The view from the steering station shall be sufficiently unobstructed in all directions.
7-2.2 A sufficiently unobstructed view in all directions from the steering station shall be
deemed to be provided if the following conditions are met:
(i) The unobstructed field of view from the helmsman’s position shall cover at
least 240° of the horizon, including at least 140° in the forward half-circle;
(ii) No window frames, posts, etc. shall be placed in the helmsman’s normal line of
vision;
(iii) The view through the windows in the helmsman’s normal line of vision shall
be kept clear under all weather conditions (rain, snow, frost) by suitable
devices;
(iv) If, in spite of the field of view of 240º or more, the sufficiently unobstructed
view cannot be ensured astern, the competent authority may require other
measures to be taken, such as the installation of auxiliary optical devices.
ECE/TRANS/SC.3/172/Rev.1
page 42

7-2.3 The dead area of vision forward of the bow of the unloaded vessel shall not extend
beyond 250 m. The use of optical devices to reduce the dead area shall not be considered for the
purposes of this requirement.
7-3 REQUIREMENTS CONCERNING CONTROL, DISPLAY AND
MONITORING EQUIPMENT
7-3.1 The controls shall move easily into the operating position, which shall be
unmistakably clear.
7-3.2 Monitoring instruments shall be easily readable whatever the lighting conditions
inside the wheelhouse. Their illumination shall be capable of continuous adjustment to the point
of extinction, so that the illumination is not dazzling and at the same time there is no impairment
of visibility.
7-3.3 There shall be a system for testing the warning lights.
7-3.4 It shall be possible to establish clearly whether a system is in operation. If its
functioning is indicated by means of a warning light, the latter shall be green.
7-3.5 Any malfunctioning or failure of systems that require monitoring shall be indicated
by means of red warning lights.
7-3.6 An audible warning shall sound at the same time that the red warning lights light up.
The audible warnings may consist of a single, common signal. The sound pressure level of that
signal shall exceed the maximum sound pressure level of the ambient noise at the steering station
by at least 3 dB(A).
7-3.7 The audible warning system may be switched off after the malfunction or failure has
been confirmed. This shutdown shall not prevent the alarm signal from being triggered by other
malfunctions. The red warning lights shall only go out when the malfunction has been corrected.
7-3.8 The monitoring and display devices shall be automatically connected to an
alternative power supply if the main power supply fails.
7-3.9 Devices for the remote control of the steering gear as a whole shall be installed
permanently and so that the heading selected is clearly visible. If the remote control devices can
be disengaged, they shall be fitted with an indicator showing whether the device is “in use” or
“not in use”. The arrangement and the manipulation of the controls shall be functional.
Impermanent remote-control equipment for systems that are subsidiary to the steering system,
such as active bow rudders, shall be acceptable provided that such a subsidiary installation can
be activated by means of an override at any time within the wheelhouse.

7-4 RADAR EQUIPMENT AND RATE-OF-TURN CONTROL

7-4.1 The radar equipment and rate-of-turn indicators must be of types that have been
approved by the competent authorities. The requirements of the competent authority concerning
installation and operational monitoring shall be met. Inland ECDIS equipment which may be
used in Navigation Mode shall be considered to be radar equipment. The Inland ECDIS
equipment shall also meet the requirements of the Inland ECDIS Standard prescribed by
resolution No. 48 (TRANS/SC.3/156), revised.
 ECE/TRANS/SC.3/172/Rev.1
page 43

7-4.2 The radar indicator must be located in such a way as to permit the boatmaster to
monitor the situation around the vessel on the indicator and to control the vessel from his/her
post. The distance from the vessel's steering station to the radar indicator shall not exceed 800
mm.
7-4.3 Wireless remote control panels for radar equipment are not permitted.
7-4.4 The radar equipment must have a built-in operational monitoring feature permitting
the boatmaster to check variations in operating parameters and to set the instrument correctly
when radar targets are unavailable.
7-4.5 The image on the radar indicator must be clearly visible irrespective of the lighting
conditions in the wheelhouse. The illumination of the controls and the indicator should not be so
intense as to dazzle the boatmaster when he/she is operating the vessel.
7-4.6 The radar antenna must be installed so as to ensure that there is the best possible
coverage on the indicator screen along the vessel's course, with no dead sectors within 5° to port
or starboard, and that the coverage of the horizon is, if possible, unobstructed by superstructure,
piping or other structures.
7-4.7 The antenna must be installed sufficiently high up to ensure that the high-frequency
radiation flux density on open decks where there may be people does not exceed the permitted
level.
7-4.8 Onboard radar equipment must be electrically operated from the main and
emergency power supplies.
7-4.9 The rate-of-turn indicator must be located ahead of the helmsman and within his/her
field of vision, and as close as possible to the screen of the radar equipment.
7-4.10 Where rate-of-turn regulators are used, it shall be possible to release the rate-of-turn
control in any position without any change occurring in the selected rate. The sector through
which the control rotates shall be large enough to ensure that it can be positioned with sufficient
accuracy. The neutral position shall be perceptibly distinguishable from the other positions.
Illumination of the scale shall be continuously adjustable.
7-4.11 Departures from or additions to the requirements listed above shall be permitted on
condition that all departures and additions are validated by the establishment of better working
conditions for boatmasters or the improvement of the operating and technical specifications of
radar equipment.
7-5 ALARM SYSTEM
7-5.1 The helmsman must have within reach an on/off switch controlling the alarm signal;
switches which automatically return to the off position when released are not acceptable.
7-5.2 There shall be a general alarm system, as well as an independent alarm system which
reaches open decks; accommodation spaces; engine rooms; pump rooms, where appropriate, and
other service premises.
7-5.3 The sound pressure level for the alarm signal shall be at least 75 dB(A) within the
accommodation area. In the engine rooms and pump rooms the alarm signal shall take the form
of a flashing light that is visible on all sides and clearly perceptible at all points.
ECE/TRANS/SC.3/172/Rev.1
page 44

7-6 SPECIAL WHEELHOUSE ARRANGEMENTS FOR RADAR STEERING BY

ONE PERSON
7-6.1 General provision
A wheelhouse shall be deemed to be specially arranged for radar steering, by one
person, if it meets the requirements of this section.
7-6.2 General requirements relating to design
7-6.2.1 The wheelhouse shall be designed in such a way that the helmsman shall be able to
accomplish his/her task while seated.
7-6.2.2 All appliances, instruments and controls shall be so arranged that the helmsman can
use them conveniently during the voyage without leaving his/her seat and without losing sight of
the radar screen.
7-6.2.3 The radar display shall be placed in the wheelhouse forward of the helmsman's
position in such a way that the helmsman can observe the image on the screen with no significant
change in his/her line of vision. The radar image shall continue to be perfectly visible, without a
mask or screen, whatever the lighting conditions applying outside the wheelhouse. The rate-of-
turn indicator shall be installed directly above or below the radar screen or be incorporated
within.
7-6.3 Signalling equipment
7-6.3.1 Signal lights shall be controlled from a light-control switchboard on which the tell-
tale lamps shall be arranged in position corresponding to the actual positions of the signal lights.
Failure of a signal light shall cause the corresponding tell-tale lamp to go out or to be signalled in
another manner by the corresponding warning light.
7-6.3.2 It shall be easy to operate the acoustic warning signals while performing steering
operations.
7-6.4 Installations for manoeuvring the vessel and controlling the propelling machinery
7-6.4.1 The vessel's steering gear shall be controlled by one lever, which can be easily
manipulated manually. Every movement of the steering device shall be accompanied by an
exact indication of the position of the rudders. The neutral position shall be perceptibly
indicated. The rudders shall remain in position in the absence of further actuations of the
steering device.
7-6.4.2 If the vessel is also fitted with reversing rudders or bow rudders, they shall be
controlled by separate devices meeting the above requirements. This requirement shall also
apply to convoys where the steering gear of vessels other than the vessels propelling the convoy
is used.
7-6.4.3 The direction of the propulsion thrust imparted to the vessel and the rotational speed
of propellers or main machinery shall be displayed.
7-6.4.4 An emergency stopping device for the main machinery shall be provided and shall
function independently of the remote control system.
 ECE/TRANS/SC.3/172/Rev.1
page 45

7-6.5 Installations for anchor manoeuvres

The helmsman shall be able, without leaving his/her seat, to drop anchors which are
necessary for an emergency stop of the vessel.
7-6.6 Communication equipment
7-6.6.1 Vessels shall be fitted with a radiotelephone installation for ship-to-ship and ship-to-
shore communication. Reception shall be by loudspeaker and transmission by fixed microphone.
Reception/transmission shall be selected by a push-button.
7-6.6.2 The connection to the public communication system, if available, shall be
independent of the installation referred to in paragraph 7-6.6.1.
7-6.6.3 There shall be a voice intercommunication network on board. It shall enable the
helmsman to communicate at least with the bow of the vessel or the head of the convoy, the
boatmaster’s cabin, the crew accommodation and the stern of the vessel or convoy if no other
means of direct communication from the wheelhouse is possible. The voice intercommunication
network shall be so installed that the helmsman can easily use it while carrying out the steering
operations. At all sound-link locations, reception shall be by loudspeaker and transmission by
fixed microphone. The link with the bow and stern of the vessel or head and stern of the convoy
may be by radio-telephone.
7-6.7 Entry in the ship’s certificate
Where a vessel complies with the requirements of this chapter in respect of
wheelhouses that have been designed for radar navigation by one person, the following statement
shall be entered in the ship’s certificate:
“The vessel has special wheelhouse arrangements for steering on radar by one
person”.

7-7 MOVABLE WHEELHOUSES

7-7.1 General requirements
7-7.1.1 Movable wheelhouses should be fitted with an emergency lowering system. All
lowering operations should automatically trigger an audible warning signal. This requirement
shall not apply, if the risk of corporal injury which may result from lowering, is prevented by
appropriate design features.
It must be possible to leave the wheelhouse safely, whatever its position.
7-7.1.2 A vertically movable wheelhouse and its gear shall be designed in such a way as not
to adversely affect the safety of persons on board.
7-7.1.3 Hoisting and lowering shall not interfere with operations performed from the
wheelhouse.
7-7.2 Requirements relating to construction
7-7.2.1 The hoisting mechanism shall be designed to hoist at least 1.5 times the weight of the
wheelhouse fully equipped and fully manned.
ECE/TRANS/SC.3/172/Rev.1
page 46

7-7.2.2 The mechanism for hoisting the wheelhouse shall function reliably and without
jamming under all possible conditions of asymmetrical load, as well as at all angles of ship's list
and trim, which could occur during its normal operation.
7-7.2.3 The wheelhouse shall be earthed.
7-7.2.4 The feed cables for systems inside the wheelhouse shall be laid and fastened, in such
a way, as to exclude the possibility of mechanical damage to them.
7-7.2.5 The device for fastening the cables may also be used for laying hoses or pipes
leading into the wheelhouse. The distance between such hoses or pipes and the cables shall be
not less than 100 mm.
7-7.2.6 Optical signalling of the following positions shall be provided:
(i) Electric drive switchboard live;
(ii) Wheelhouse in lower terminal position;
(iii) Wheelhouse in upper terminal position.
7-7.3 Requirements relating to the hoisting gear drive
7-7.3.1 The gear for hoisting and lowering the wheelhouse shall have a power drive capable
of functioning under all conditions of the ship's operation.
7-7.3.2 Emergency lowering of the wheelhouse shall be effected under its own weight and
shall be smooth and controllable.
7-7.3.3 The hoisting mechanism shall enable the wheelhouse to stop and remain in any
position.
On board vessels intended for zones 1 and 2, the Basin administrations may require
that it shall be possible to fix the wheelhouse in different positions. A possibility for immediate
release of the fixing arrangements should be ensured under all operational conditions, inclusive
of a total power failure.
7-7.3.4 Automatic cutting out of the hoisting mechanism in the terminal positions shall be
provided.
7-7.3.5 Lowering of the wheelhouse shall be effected by one person under all conditions.
Emergency lowering control shall be possible from both inside the wheelhouse and a control
station outside. The speed of emergency lowering of the wheelhouse shall be not less than the
speed of lowering effected by means of the main drive.
7-7.3.6 The use of a self-braking hoisting mechanism shall not be permitted.
 ECE/TRANS/SC.3/172/Rev.1
page 47

CHAPTER 8
ENGINE DESIGN
8-1 MACHINERY
8-1.1 General
8-1.1.1 Machinery and their attachments shall be designed, built and installed in accordance
with the state of the art, the rules of the Administration and/or of a recognized Classification
Society. It shall be possible to start and stop the machinery, and if necessary to reverse the main
machinery, reliably, quickly and safely.
The main machinery and auxiliary machinery, boilers and pressure vessels, together
with their accessories shall be fitted with safety devices.
8-1.1.2 The liquid fuel for the main or auxiliary machinery shall have a flashpoint above
55° C. In certain cases, such as for lifeboat engines, the Administration may allow a fuel with a
flashpoint below 55° C.
8-1.1.3 Installations requiring special inspections, such as boilers and pressure vessels, shall
comply with the rules of the Administration or with the rules of a recognized Classification
Society.
8-1.1.4 The fuel system, the lubricating and cooling-water systems and the starting devices
shall conform to the requirements of the Administration or to the rules of a recognized
Classification Society.
8-1.1.5 The following parameters of the main machinery shall be monitored by means of
suitable devices, which trigger an alarm once a critical level has been reached:
(i) The temperature of the cooling water;
(ii) The lubricating oil pressure for the engines and transmissions;
(iii) The oil and air pressure of the reversing units, reversible transmissions or
propellers.
8.1.1.6 Where vessels have only one main propulsion engine, that engine shall not be shut
down automatically except in order to protect against over-speed of the engine.
8-1.2 Main machinery/shafting
8-1.2.1 The main machinery power shall make the vessel sufficiently manoeuvrable under
normal operating conditions.
8-1.2.2 The control devices shall be so constructed that they cannot be accidentally moved
from their appointed position.
8-1.2.3 A reliable and effective system of two-way communication shall be provided
between the main machinery space and the wheelhouse.
8-1.2.4 Where the main machinery is remote-controlled, a local control station shall be
provided.
ECE/TRANS/SC.3/172/Rev.1
page 48

8-1.2.5 It shall be possible to turn the main machinery over in complete safety.
8-1.2.6 If the propeller shafts cannot be disconnected, they shall be equipped with suitable
blocking devices.
8-1.2.7 Shafting shall be designed in such a way as to prevent the spread of water-polluting
lubricants.
8-1.3 Machinery space
8-1.3.1 In the machinery space the machinery, accessories and equipment shall be so placed
as to be readily accessible and safe for operation, dismantling and maintenance.
8-1.3.2 All moving parts of the machinery and transmissions dangerous to members of the
crew shall be fitted with appropriate protective devices.
8-1.3.3 The machinery and equipment shall be installed on sturdy and rigid seatings firmly
fixed to the vessel’s hull.
8-1.3.4 The machinery space shall be provided with efficient ventilation.
8-1.3.5 The floor plates of the machinery space shall be fixed and made of sufficiently firm
non-slip sheet metal. They have to be removable.
8-1.3.6 All doors and hatch covers usable as exits from the machinery space shall open and
close from both inside and outside. The covers of skylights not intended for use as exits shall be
closable from outside.
8-1.4 Gas exhaust system
8-1.4.1 All exhaust gases shall be evacuated outside the vessel. All necessary steps shall be
taken to prevent dangerous gases from penetrating the various compartments.
8-1.4.2 Exhaust pipes shall be suitably shielded, insulated or cooled. Protection against
physical contact may suffice outside the engine rooms.
8-1.4.3 Gas exhaust pipes, which pass through accommodation or the wheelhouse shall, in
those compartments, be enclosed within a gastight protective sleeve. The space between the
exhaust pipe and the sleeve shall communicate with the open air.
8-1.4.4 The exhaust pipes shall be arranged and protected in such a way that they cannot
cause a fire. If the exhaust pipes run alongside or pass through inflammable materials, those
materials shall be effectively protected.
8-1.5 Fuel system
8-1.5.1 Liquid fuels shall be stored in steel tanks or, if so required by the design of the
vessel, in an equivalent material in terms of fireproofing, this forming part of the hull or being
firmly attached to this. That requirement shall not apply to tanks having a capacity of no more
than 12 litres that have been incorporated in ancillaries at the factory. No tank for any liquid fuel
shall be installed forward of the collision bulkhead.
 ECE/TRANS/SC.3/172/Rev.1
page 49

8-1.5.2 Fuel tanks shall not be situated near sources of heat. Daily-service tanks, their
fittings and connections shall not be located above engines or gas exhaust pipes. Drip-trays shall
be placed under daily-service tanks.
8-1.5.3 Fuel transfer pumps, fuel separators and oil burners, shall be fitted with a local
control device and a stopping device situated in an easily accessible position outside the spaces
where they are installed.
8-1.5.4 Fuel pipes shall be independent of other piping systems.
8-1.5.5 Fuel may be heated only by devices allowed by the Administration.
8-1.5.6 Fuel tanks, their piping and other accessories shall be so designed and installed that
no fuel or gas can escape into the vessel. Tank valves intended for fuel sampling or water
drainage shall be of a self-closing type.
8-1.5.7 Fuel shall be supplied by means of a leak-proof connection.
8-1.5.8 If machinery can run on either light or heavy fuel, measures shall be taken to avoid
mixing different kinds of fuel by accident.
8-1.5.9 At tank outlets the pipeline for the distribution of liquid fuels shall be fitted with a
shutoff device that can be operated from the deck. That requirement shall not apply to tanks
mounted directly on the engine. Fuel pipes, their connections, seals and fittings shall be made of
materials that are able to withstand the mechanical, chemical and thermal stresses to which they
are likely to be subjected. The fuel pipes shall not be subjected to any damaging effects of heat
and it must be possible to monitor them throughout their length.
8-1.5.10 Pipes for filling liquid-fuel tanks, other than daily supply tanks, shall have their
opening above the deck and shall be fitted with a cap. Every such tank shall be fitted with a vent
pipe leading to the open air above the deck and so placed that no water can enter it. Its cross-
section shall be at least 1.25 times the cross section of the filler neck. The filler openings for fuel
tanks shall be marked distinctly.
8-1.5.11 Fuel- and lubricating oil tanks shall be provided with a capacity-gauging device that
is legible right up to the maximum filling level. External gauge columns shall be effectively
protected against impacts shall be fitted with self closing valves at their base and shall be
attached at their upper part to the tanks above their maximum filling level. The material used for
the gauge columns shall not deform under normal ambient temperatures.
8-1.5.12 Tanks which directly supply essential machinery shall be equipped with a device that
gives a visual and acoustic signal in the wheelhouse when their degree of filling is no longer
sufficient for reliable operation.
8-1.5.13 Tanks for liquid fuel or lubricating oil shall not have vertical common walls with
accommodation spaces. Fuel tanks shall not have common surfaces with drinking water tanks.
8-1.5.14 Liquid fuel tanks shall be provided with openings having leak-proof closures that are
intended to permit cleaning and inspection.
8-1.5.15 Fire hazards which might result from the splashing of liquid fuel or other
inflammable liquids on to hot surfaces shall sufficiently be prevented by:
ECE/TRANS/SC.3/172/Rev.1
page 50

(i) Suitable construction, arrangement or shielding of the high pressure pipes

carrying such liquids;
(ii) Heat-resistant insulation of hot surfaces by oil proof or sheet-metal shielding.
8-1.6 Bilge pumping systems
8-1.6.1 It shall be possible to pump each watertight compartment dry separately. However,
that requirement shall not apply to compartments that are normally sealed hermetically during
operation.
8-1.6.2 Vessels requiring a crew shall be equipped with two separate bilge pumps which
shall not be installed within the same space. At least one of these shall be motor driven.
However, if the power units for such vessels develop less than 225 kW or with deadweight of
less than 350 t, respectively, or where vessels not intended for the carriage of goods have a water
displacement of less than 250 m³, one manually operated or motor-driven pump will suffice.
Each of the required pumps shall be capable of use on each watertight compartment.
8-1.6.3 The pumping capacity of the first bilge pump shall be calculated by the formula:
Q1 = 0.1 ⋅ d1
2
[1/min]
d1 is calculated by the formula
d1 = 1.5 L (B + H) + 25 [mm] .
The pumping capacity of the second bilge pump shall be calculated, by the following
formula:
Q2 = 0.1⋅ d 2
2
[1/min]
d 2 is calculated by the formula:
d 2 = 2 l ( B + H ) + 25 [mm] .
However, the value d 2 may be taken not to exceed value d1 . The length of the
longest sealed compartment shall be taken to be l in order to determine Q2 .

In these formulae:
l = the length of the corresponding sealed compartment, in m;
d1 = the calculated internal diameter of the drainage pipe, in mm;
d2 = the calculated internal diameter of the drainage spur, in mm.

8-1.6.4 Where the drainage pumps are connected to a drainage system, the drainage pipes
shall have an internal diameter of at least d1 , in mm, and the drainage spurs an internal diameter
of at least d 2 , in mm. Where vessels are less than 25 m in length, these values may be reduced
to 35 mm.
8-1.6.5 Only self-priming drainage pumps are acceptable.
8-1.6.6 There must be at least one strainer on both the starboard and port sides of all flat-
bottomed, drainable compartments that are wider than 5 m.
 ECE/TRANS/SC.3/172/Rev.1
page 51

8-1.6.7 It may be possible to drain the after-peak to the main engine room by means of an
easily accessible self-closing valve attached to the after-peak bulkhead.
8-1.6.8 The drainage spurs for the various compartments shall be linked to the bilge main by
means of closing and non-return valves or equivalent devices.
The compartments or other spaces fitted out for ballast may only be linked to the
drainage system by means of a single closing device. That requirement shall not apply to holds
fitted out for ballast. Such holds shall be filled with ballast water by means of ballast piping that
is permanently installed and independent of the drainage pipes, or by means of spurs consisting
of flexible pipes or intermediate pipes that can be connected to the main drain. Water intake
valves located in the base of the hold shall not be permitted for this purpose.
8-1.6.9 The hold bottoms shall be fitted with depth gauges.

8-2 AUTOMATION
8-2.1 Scope
The provisions of this section are to be complied with, if no continuous watch is kept
in the engine room.
8-2.2 General provisions
8-2.2.1 Automation systems and their elements should comply with the requirements of
9-1.1, 9-2.18 and 9-2.19.
8-2.2.2 The main machinery and its essential auxiliaries shall be equipped for unattended
operation in the machinery space. Remote control, alarm and safety systems shall be such as to
ensure smooth functioning of the plant and effective monitoring of all its important parts.
8-2.2.3 Care shall be taken to ensure that, in the event of a malfunction of the automation
systems or breakdown of the electrical, pneumatic or hydraulic supply system for it, the
controlled components remain in the condition in which they were before the failure. The failure
shall be signalled.
8-2.2.4 Automated or remote-controlled machinery shall also be equipped with local manual
controls. The manual controls shall be such that they cannot be put out of action by any
breakdown of the automated or remote-controlled system.
8-2.2.5 It shall be possible to keep the remote control or automated control system supplied
with energy from the second source, which shall come into operation automatically upon failure
of the main supply source. If the second power source is not permanently available while the
vessel is under way, a buffer device is required.
8-2.2.6 Automation system devices are to be so constructed that their function can be
checked during the operation of the plant.
8-2.2.7 On the remote control station, it shall be indicated that the given commands have
been executed.
ECE/TRANS/SC.3/172/Rev.1
page 52

8-2.3 Remote control and automated remote control of propulsion installation

8-2.3.1 Automated remote control or remote control of the propulsion installation shall be
possible only from one station at a time. Secondary control stations interconnected with the
control mechanisms in the wheelhouse are allowed. If there is more than one control station, an
indicator shall be fitted at each station showing from which station the installation is controlled.
The changeover of control between the wheelhouse and the engine room shall be possible only
from the wheelhouse.
8-2.3.2 The main machinery shall be equipped with an emergency stopping device in the
wheelhouse, independent of the automated remote control system or remote control system.
8-2.3.3 The design of the automated remote control system or remote control system shall be
such, that in the event of its failure, an alarm will be given and the present speed and direction of
propulsion will be maintained until another control is in operation.
8-2.3.4 Indicators shall be fitted in the wheelhouse for the direction of the propulsion thrust
imparted to the vessel and the rotational speed of the propellers.
8-2.3.5 Where the remote control system of the propulsion installation is automated, the
number of successive automatic attempts to produce a start shall be limited in order to keep
enough air pressure for starting. A signal lamp shall light up at the lowest air pressure still
sufficient for starting the main machinery.
8-2.4 Alarm system
8-2.4.1 The alarm system shall sound an acoustic signal in the wheelhouse and engine room
and actuate visual signals for each separate alarm function.
8-2.4.2 The alarm system has to comply with the requirements of 9-2.17.1.
8-2.5 Safety system
8-2.5.1 A safety system shall be provided, such that a breakdown in the machinery or boilers
presenting an immediate danger, will initiate the automatic shutdown of the affected part of the
plant and activate an alarm.
8-2.5.2 The wheelhouse shall be equipped with devices overriding the safety system of the
main machinery with the exception of protection against over speeding, as well as an alarm
indicating that the safety system has been switched off.
8-2.6 Fire detection system for the machinery space
8-2.6.1 A fire detection system, self-monitoring and with facilities for periodic testing, shall
be installed in the machinery space.
8-2.6.2 The fire-detection system shall be capable of detecting rapidly an outbreak of fire in
any part of the machinery space under any normal conditions of operation of the machinery. The
detection system shall actuate acoustic and visual alarms, different from the signals emitted by
any other system, in the wheelhouse and places where they can be heard or seen by the crew
member on duty.
 ECE/TRANS/SC.3/172/Rev.1
page 53

8-2.6.3 It shall be possible to keep the fire detection system supplied with energy from the
second source, which shall come into operation automatically upon failure of the main supply
source. If the second power source is not permanently available, a buffer device is required.
8-2.7 Bilge-level alarm
A bilge-level alarm system shall be fitted in all machinery spaces. The level sensor
or sensors shall be suitably placed to ensure an early warning.
8-2.8 Standby installations
Where the equipment of importance for the safety of navigation is backed up by
standby units, an automatic changeover device shall be provided that actuates a signal when
operated.
 ECE/TRANS/SC.3/172/Rev.1
page 55

CHAPTER 8A
EXHAUST AND POLLUTANT
PARTICULATE EMISSIONS FROM DIESEL ENGINES
8A-1 DEFINITIONS
8A-1.1 For the purposes of this chapter:
8A-1.1.1 “Engine”: an engine operating according to the compression-ignition principle
(diesel engine), including main and auxiliary machinery engines;
8A-1.1.2 “Remanufactured engine”: a reconditioned second-hand engine, similar to the engine
replaced in terms of power, rating and conditions of installation;
8A-1.1.3 “Type approval”: the decision whereby the competent authority certifies that an
engine type, family or group meets the technical requirements of this chapter in respect of
emissions of engine exhaust and air-pollutant particulates;
8A-1.1.4 “Installation check”: the procedure whereby the competent authority ascertains that
an engine installed in a vessel meets the technical requirements of this chapter as regards exhaust
and air-pollutant emissions, including those occurring after any modifications and adjustments
which may have taken place after type approval;
8A-1.1.5 “Interim check”: the procedure whereby the competent authority ascertains that an
engine installed in a vessel meets the technical requirements of this chapter as regards exhaust
and air-pollutant emissions, including those occurring after any modifications and/or adjustments
which may have taken place after the mounting check;
8A-1.1.6 “Special check”: the procedure whereby the competent authority ascertains that an
engine used on board a vessel still meets the technical requirements of this chapter as regards
exhaust and air-pollutant emissions after each major modification;
8A-1.1.7 “Engine type”: a batch of engines which are identical in terms of the essential
features of the engine; at least one unit of the engine type must be constructed;
8A-1.1.8 “Engine family”: a grouping of engines by the manufacturer, approved by the
competent authority, which as a result of their design must all have similar features as regards
the level of exhaust and air-pollutant particulate emissions and meet the requirements of this
chapter;
8A-1.1.9 “Engine group”: a group of engines selected by the manufacturer, approved by the
competent authority, which as a result of their design must all have similar features as regards
the level of exhaust and air-pollutant particulate emissions and meet the requirements of this
chapter, the adjustment or modification of individual engines being permissible after the type
approval within fixed limits;
8A-1.1.10 “Rated power”: the net power of the engine at rated speed and at full load;
8A-1.1.11 “Type approval certificate”: the document by which the competent authority certifies
the type approval;
ECE/TRANS/SC.3/172/Rev.1
page 56

8A-1.1.12 “Collection of engine parameters”: the document containing all the parameters,
including the parts (components) and adjustments of the engine, which have an impact on
exhaust and air-pollutant particulate emissions and their modifications.

8A-2 FUNDAMENTAL PRINCIPLES

8A-2.1 This chapter shall apply to all engines of a net power equal to or greater than 37 kW
installed on board vessels.

8A-2.2 Carbon monoxide ( CO ), hydrocarbon ( HC ), oxide of nitrogen ( NO x ) and

particulate ( PT ) emissions from these engines shall not exceed the following values, in terms of
the swept volume per cylinder in litres ( SV ):

&DWHJRU\ 6ZHSWYROXPH69 &DUERQPRQR[LGH 6XPRI 3DUWLFXODWHV

>O@ &2  K\GURFDUERQVDQG 30 
1HWSRZHU3  R[LGHVRIQLWURJHQ 
>N:@ >JN:K@ +&12; >JN:K@ >JN:K@
    
9 69”DQG3•   
9 ”69   
9 ”69   
9 ”69   
9 ”69   
9 ”69”DQG   
3
9 ”69DQG   
3•
9 ”69   
9 ”69   

Or, alternatively, in terms of rated power PN :

5DWHGSRZHU &DUERQ +\GUR 2[LGHVRIQLWURJHQ 3DUWLFXODWHV

31 PRQR[LGH FDUERQV 12;  30 
 &2  +&   
>N:@ >JN:K@ >JN:K@ >JN:K@ >JN:K@
    
”31    
”31    
”31    
31•   Q•PLQ  
”QPLQ ⋅Q  
QPLQ 

8A-2.3 The requirements in paragraph 8A-2.2 shall not apply to engines installed on board
prior to 1 July 2009, nor to remanufactured engines installed prior to 31 December 2011
inclusive, on board vessels in service at 31 December 2006.
 ECE/TRANS/SC.3/172/Rev.1
page 57

8A-2.4 Compliance with the requirements of paragraph 8A-2.2 shall be checked by using the
ISO test procedure as specified in ISO 8178-4:2007 and IMO MARPOL 73/78, Annex VI
( NO x Code).

8A-2.5 Compliance with the requirements of paragraph 8A-2.2 by an engine type, group or
family shall be observed by means of a type inspection. The type inspections shall be certified
by a type approval certificate. Type approvals for all engines shall be granted according to
UNECE Regulation No. 96 annexed to the 1958 Agreement concerning the Adoption of Uniform
Technical Prescriptions for Wheeled Vehicles, Equipment and Parts which can be Fitted and/or
be Used on Wheeled Vehicles and the Conditions for Reciprocal Recognition of Approvals
Granted on the basis of these Prescriptions. The owner or their representative shall be required
to present a copy of the type approval certificate to the competent authority on the inspection of
vessels with a view to obtaining a ship’s certificate in accordance with the provisions of chapter
2. A copy of the type approval certificate and the collection of engine parameters shall also be
on board.
8A-2.6 After the installation of the engine on board, but before it is brought into service, an
installation check shall be made. This check, which is part of the initial inspection of the vessel
or of a special inspection justified by the installation of the engine in question, leads either to the
registration of the engine in the first ship’s certificate drawn up or to an amendment to the
existing ship’s certificate.
8A-2.7 Interim engine checks shall be effected as part of a periodical inspection in
accordance with paragraph 8A-2.4.
8A-2.8 A special check shall be made after each major modification to the engine with an
impact on exhaust and air-pollutant particulate emission.
8A-2.9 The type approval and identification numbers (designated and arranged according to
UNECE Regulation No. 96) of all the engines referred to in this chapter installed on board a
vessel shall be registered in the ship’s certificate by the competent authority on the inspection of
vessels.
 ECE/TRANS/SC.3/172/Rev.1
page 59

CHAPTER 8B
PREVENTION OF WATER POLLUTION AND
ABATEMENT OF NOISE PRODUCED BY VESSELS
8B-1 REQUIREMENTS FOR COLLECTION FACILITIES FOR USED OIL AND
OIL-CONTAINING WATER
8B-1.1 All necessary steps should be taken to reduce the leakage of oil on board vessels.
Drip-trays to collect any leaking fuel or other oils shall be placed under fittings of fuel and other
oil tank connections. The contents of drip trays shall be conveyed to collecting tanks.
8B-1.2 Vessels having installations which use liquid fuel on board shall be equipped with:
(i) Collecting reservoirs for oil containing water;
(ii) Systems for draining oil-containing water to the collecting reservoirs;
(iii) Standard connections for the discharge of oil-containing water to reception
facilities outside the vessel.
The Administration may consider the engine-room bilges as a collecting reservoir for
oil-containing water.
8B-1.3 Tanks used as reservoirs must be fitted with:
(i) An orifice for access and cleaning;
(ii) A breather pipe with a flame-arrester leading to the open air;
(iii) A device which activates optical and acoustic signals in the wheelhouse or the
central control post when the level of the liquid reaches 80 % of the tank
capacity;
(iv) A device for measuring the level of the liquid;
(v) If heavy fuel is used on the vessel or the tank is installed in a place where
negative temperatures are possible during operation, the tank shall be fitted
with a heating facility.
8B-1.4 Standard discharge connections shall conform to the requirements of Basin
administrations and shall be of either flange or quick-release type. Flange-type connections are
fitted with a flange with an outer diameter of 215 mm and six slotted holes of 22 mm on a pitch
circle diameter of 183 mm. The flange is intended for pipes with an internal diameter of up to
125 mm, has a thickness of 20 mm and is to be manufactured from steel or an equivalent
material with a flat machined surface. The flange, together with a gasket of oil-resistant
material, must be designed for a working pressure of 0.6 MPa. Coupling is effected by means of
six 20 mm-diameter bolts of the requisite length. Standard discharge connections are to be fitted
with blank flanges.
Quick-release type connections shall conform to a recognized European standard.
A stop button for the transfer pump, if any, must be installed in the vicinity of the
discharge connections.
8B-1.5 The installations for draining the machinery space shall be so arranged that any oil or
oil-containing water shall remain aboard. Where a drainage system incorporates permanently
ECE/TRANS/SC.3/172/Rev.1
page 60

fixed pipes, the bilge drainage pipes shall be fitted with closing devices sealed in the closed
position by the Administration. The number and position of those closing devices shall be
mentioned in the ship’s certificate.
8B-1.6 In order to store spent oils there shall be one or several specific receptacles in the
engine room with total capacity corresponding to at least 1.5 times the quantity of the spent oils
from the sumps of all of the internal combustion engines and all of the equipment installed,
together with the hydraulic-fluid installations.
Should operating conditions so require, the Administration may prescribe other
standards for the dimensions of these receptacles. If the total quantity of oil contained in the
sumps of all of the internal combustion engines and all of the equipment installed, together with
the hydraulic fluid systems is 300 litres or more, the receptacles shall be fixed and be fitted with
a device which activates optical and acoustic signals in the wheelhouse or the central control post
when the level of the liquid reaches 80 % of the receptacle capacity.
8B-1.7 For vessels operated over short distances only or for ferries, the Administration may
no longer require the receptacles mentioned in 8B-1.6.
8B-2 REQUIREMENTS CONCERNING EQUIPMENT FOR PROCESSING
OIL-CONTAINING WATER
8B-2.1 The Administration may allow the use of separation and filtration equipment. In this
case such equipment and its components shall meet the conditions required by the
Administration.
8B-2.2 In cases where discharges of any oil/water mixtures are generally prohibited on
waterways, the Administration may put oil separation and filtration devices out of action by
sealing.
8B-3 REQUIREMENTS CONCERNING FACILITIES FOR COLLECTING AND
STORING DOMESTIC WASTE WATER
8B-3.1 Vessels having or intended to have on board more than the maximum number of
people that the relevant Basin administration will allow before domestic waste water retention or
treatment facilities are required on board, shall be equipped with:
(i) A collecting tank for domestic waste-water;
(ii) Systems for transferring domestic waste water to the collecting tank and
discharging it from the tank to reception facilities outside the vessel or
overboard in areas and under conditions which are allowed;
(iii) Standard assemblies for the discharge of domestic waste water to reception
facilities,
or, alternatively, with a domestic waste water treatment plant according to paragraph 8B-4 below.
Administrations may apply requirements different from those in 8B-3.1 with regard
to equipment of vessels navigating within its inland waterways.

8B-3.2 The volume of domestic waste-water collection tanks, V ww shall be calculated by the
following formula:
Vww = G ww ⋅ N ⋅ T,
 ECE/TRANS/SC.3/172/Rev.1
page 61

where GWW = domestic waste-water discharge per person per day according to
operating conditions;
N = maximum admissible number of people on board;
T = period between emptyings of the on-board tanks in days.
8B-3.3 Tanks must be fitted with a device which activates optical and acoustic signals in the
wheelhouse or the central control post when the level of the liquid reaches 80 % of the tank
capacity.
8B-3.4 Tanks shall have a smooth inner surface (i.e., framework and fittings on the outside)
and a bottom sloping towards the drain.
8B-3.5 Tanks shall be fitted with installations for breaking up sediment and cleaning.
8B-3.6 For purposes of discharge of the tanks, vessels shall be equipped with pumps.
Pumps need not be fitted on small vessels.
8B-3.7 Standard discharge connections shall conform to the requirements of Basin
administrations and shall be of either flange or quick-release type. Flange-type connections are
fitted with a flange with an outer diameter of 210 mm and four slotted holes of 18 mm on a pitch
circle diameter of 170 mm. The flange is intended for pipes with an internal diameter of up to
100 mm, has a thickness of 16 mm and is to be manufactured from steel or an equivalent
material with a flat machined surface. The flange, together with a gasket, must be designed for a
working pressure of 0.6 MPa. Coupling is effected by means of four 16 mm-diameter bolts of the
requisite length. Standard discharge connections are to be fitted with blank flanges.
Quick-release type connections shall conform to a recognized European standard.
8B-4 REQUIREMENTS CONCERNING EQUIPMENT FOR THE TREATMENT
OF DOMESTIC WASTE WATER
The Administration may allow the use of the equipment for the treatment of domestic
waste water. In this case such equipment and its components shall meet the conditions required
by the Administration.
8B-5 FACILITIES FOR THE COLLECTION AND STORAGE OF VESSEL
OPERATION REFUSE
A separate container must be provided for vessel operation refuse.
8B-6 FACILITIES FOR THE COLLECTION, STORAGE AND TREATMENT OF
HOUSEHOLD REFUSE
8B-6.1 Manned vessels and passenger vessels must be equipped with facilities for the
collection of household refuse.
8B-6.2 The volume of household refuse collection facilities, Vhr shall be calculated by the
formula:
V hr = G hr ⋅ N ⋅ T

where Ghr = household refuse discharge per person per day according to operating
conditions;
N = maximum admissible number of people on board;
ECE/TRANS/SC.3/172/Rev.1
page 62

T = period between emptyings of the on-board collection facilities.

8B-6.3 Household refuse-collection devices must have easy-to-clean internal surfaces.
8B-6.4 Household refuse-collection equipment must have tightly-closing lids and be
installed in well-ventilated areas, preferably on the open deck, and must have fittings allowing
them to be securely attached to the deck.
8B-6.5 Removable equipment must be designed in such a way that it can be moved by one
or two people. Otherwise, appropriate additional equipment must be provided for transport.
8B-6.6 For small vessels, household refuse may be collected in disposable dense
polyethylene bags.
8B-7 REQUIREMENTS CONCERNING FACILITIES FOR THE ELIMINATION
OF HOUSEHOLD AND VESSEL OPERATION REFUSE
8B-7.1 The Administration may allow the use of a household and vessel operation refuse
incinerator. In this case, such equipment and its components shall meet the conditions required
by the Administration.
8B-7.2 In cases where the operation of household and vessel operation refuse incinerators is
prohibited on certain waterways, the Administration may put such devices out of action by
sealing.
8B-8 NOISE EMITTED BY VESSELS
8B-8.1 Noise emitted by vessels under way, in particular engine intake and exhaust noise,
shall be damped by appropriate means.
8B-8.2 Noise emitted by vessels shall not exceed 75 dB(A) at a lateral distance of 25 m from
the shipside.
8B-8.3 With the exception of trans-shipment operations, the noise emitted by stationary
vessels shall not exceed 65 dB(A) at a lateral distance of 25 m from the shipside.
 ECE/TRANS/SC.3/172/Rev.1
page 63

CHAPTER 9
ELECTRICAL INSTALLATIONS
9-1 GENERAL
9-1.1 General requirements
9-1.1.1 Where there are no specific requirements concerning certain parts of an installation
the safety level shall be considered satisfactory where those parts have been produced in
accordance with an approved European standard or in accordance with the requirements of a
recognized Classification Society. The relevant documents shall be submitted to the competent
authority on inspection of vessels.
9-1.1.2 The electrical and electronic equipment shall be designed for permanent lists of up to
15° and ambient inside temperatures of between 0 and +40 °C, and on the deck between -20 °C
and +40 °C. It shall function perfectly at those limits. The Administration may extend the
outside temperature range in accordance with local climatic conditions.
9-1.1.3 The electrical and electronic equipment and appliances shall be fully accessible and
easy to maintain.
9-1.2 Electrical supply systems
9-1.2.1 Where vessels are fitted with an electric system that system shall have at least two
power sources in such a way that where one power source fails the remaining source is able to
supply the equipment needed for navigational safety for an appropriate period of time to be
determined by the Administration of the river basin.
9-1.2.2 Adequate sizing of the power supply shall be demonstrated by means of a power
balance. An appropriate simultaneity factor may be taken into account.
9-1.3 Documents required to be available on board
Documents containing the following, and duly stamped by the competent authority
on inspection of vessels, shall be kept on board:
(i) A set of instructions for use and a description of the electrical installations;
(ii) Wiring diagrams concerning all of the electrical equipment;
(iii) Switching diagrams for the main control panel, the emergency-installation
panel and the distribution panels, together with the most important technical
data such as the amperage and rated current of the protection and control
devices;
(iv) Power data concerning the electrical service equipment;
(v) Types of cable and statement of conductor cross sections;
(vi) All other particulars essential for an assessment of safety.
It is not necessary to keep such documents on board unmanned vessels, but they must
be available at all times from the owner.
ECE/TRANS/SC.3/172/Rev.1
page 64

9-2 TECHNICAL REQUIREMENTS

9-2.1 Maximum permissible voltages
9-2.1.1 The following voltages shall not be exceeded:
0D[LPXPSHUPLVVLEOHYROWDJH
7\SHRILQVWDOODWLRQ 'LUHFWFXUUHQW 6LQJOHSKDVH 7KUHHSKDVH
DOWHUQDWLQJ DOWHUQDWLQJ
FXUUHQW FXUUHQW
D3RZHUDQGKHDWLQJLQVWDOODWLRQVLQFOXGLQJWKHUHOHYDQWVRFNHWV 9 9 9
E/LJKWLQJFRPPXQLFDWLRQVFRPPDQGDQGLQIRUPDWLRQ 9 9 
LQVWDOODWLRQVLQFOXGLQJWKHUHOHYDQWVRFNHWV
F6RFNHWVLQWHQGHGWRVXSSO\SRUWDEOHGHYLFHVXVHGRQRSHQ   
GHFNVRUZLWKLQQDUURZRUGDPSPHWDOORFNHUVDSDUWIURP
ERLOHUVDQGWDQNV
,QJHQHUDO 9 9  
:KHUHDFLUFXLWVHSDUDWLRQWUDQVIRUPHURQO\VXSSOLHVRQH  9  
DSSOLDQFH
:KHUHSURWHFWLYHLQVXODWLRQ GRXEOHLQVXODWLRQ DSSOLDQFHV 9 9 
DUHXVHG
:KHUHP$GHIDXOWFXUUHQWFLUFXLWEUHDNHUVDUHXVHG  9 9
G0RELOHFRPSRQHQWVVXFKDVHOHFWULFDOHTXLSPHQWIRU 9 9 9
FRQWDLQHUVEORZHUVDQGPRELOHSXPSVZKLFKDUHQRW
QRUPDOO\KDQGOHGGXULQJVHUYLFHDQGXVHFRQGXFWLQJSDUWV
ZKLFKDUHRSHQWRSK\VLFDOFRQWDFWDUHHDUWKHGE\PHDQVRID
SURWHFWLYHFRQGXFWRUWKDWLVLQFRUSRUDWHGLQWRWKHFRQQHFWLQJ
FDEOHDQGZKLFKLQDGGLWLRQWRWKDWHIIHFWLYHFRQGXFWRUDUH
FRQQHFWHGWRWKHKXOOE\WKHLUORFDWLRQRUDQRWKHUFRQGXFWRU
H6RFNHWVLQWHQGHGWRVXSSO\SRUWDEOHDSSOLDQFHVXVHGLQVLGH 9  9  
ERLOHUVDQGWDQNV
&RPPHQWV
 :KHUHWKDWYROWDJHFRPHVIURPKLJKHUYROWDJHQHWZRUNVJDOYDQLFVHSDUDWLRQPXVWEHXVHG LVRODWLQJWUDQVIRUPHU 
 $OORIWKHSROHVRIWKHVHFRQGDU\FLUFXLWVKDOOEHLQVXODWHGIURPWKHHDUWK

9-2.1.2 If the required protective measures are applied higher voltages are acceptable:
(i) For power installations where their power so requires;
(ii) For special on-board installations such as radio and ignition systems.
 ECE/TRANS/SC.3/172/Rev.1
page 65

9-2.2 Protection against physical contact, the insertion of solid objects and the infiltration
of water
The type of minimum protection for parts of permanent fixtures shall be as set out in
the table below or may be stricter in accordance with the requirements of the Administration.

7\SHRIPLQLPXPSURWHFWLRQ
LQDFFRUGDQFHZLWK,(&SXEOLFDWLRQ 
3DQHOV
/RFDWLRQ ,QVWDOODWLRQ /LJKWLQJ
*HQHUDWRUV 0RWRUV 7UDQVIRUPHUV 'LVWULEXWRUV
 HTXLSPHQW GHYLFHV
6ZLWFKHV
6HUYLFHSUHPLVHVHQJLQHURRPV    
,3 ,3 ,3 ,3
VWHHULQJJHDUFRPSDUWPHQWV ,3 ,3
+ROGV     ,3 ,3
%DWWHU\DQGSDLQWORFNHUV      ,3
X (;  
8QURRIHGGHFNVDQGVWHHULQJ  ,3  ,3 ,3 ,3
SRVLWLRQV
(QFORVHGZKHHOKRXVH  ,3 ,3 ,3 ,3 ,3
$FFRPPRGDWLRQDSDUWIURPKHDOWK    ,3 ,3 ,3
IDFLOLWLHVDQGZDVKURRPV
+HDOWKIDFLOLWLHVDQGZDVKURRPV  ,3 ,3 ,3 ,3 ,3
5HPDUNV
  :KHUHDSSOLDQFHVUHOHDVHODUJHDPRXQWVRIKHDW,3
  :KHUHDSSOLDQFHVRUSDQHOVGRQRWKDYHWKLVW\SHRISURWHFWLRQWKHLUORFDWLRQVKDOOPHHWWKHFRQGLWLRQVDSSO\LQJWRWKDWW\SHRI

SURWHFWLRQ
  (OHFWULFDOHTXLSPHQWRIWKHFHUWLILHGVDIHW\W\SHLQDFFRUGDQFHZLWK,(&3XEOLFDWLRQ

9-2.3 Explosion proofing

Only electrical equipment that has been explosion proofed, (safety-certified) may be
installed in premises where potentially explosive gases or mixtures of gases are likely to
accumulate, such as compartments set aside for accumulators or the storage of highly
inflammable products. No light switches or other electrical appliances shall be installed on those
premises. The explosion proofing shall take account of the characteristics of the potentially
explosive gases or mixtures of gases that are likely to arise (explosion-potential group,
temperature class).
9-2.4 Distribution systems
9-2.4.1 The following distribution systems are allowed for direct and single-phase
alternating current:
(i) Two-conductor systems of which one is earthed;
(ii) Single-conductor systems using the hull-return principle, only for local
installations (for example, starting gear for combustion engines, cathodic
protection);
(iii) Two-conductor systems that are insulated from the hull.
ECE/TRANS/SC.3/172/Rev.1
page 66

9-2.4.2 The following distribution systems are allowed for three-phase alternating current:
(i) Four-conductor systems with earthing of the neutral point, not using the hull
return principle;
(ii) Three-conductor systems insulated from the hull;
(iii) Three-conductor systems with earthing of the neutral point using the hull return
principle except for terminal circuits.
9-2.4.3 All such systems shall comply with the rules of the Administration or of a recognized
Classification Society.
9-2.4.4 The use of other distribution systems shall be subject to the prior consent of the
Administration.
9-2.4.5 Connection to the shore or other external networks
9-2.4.5.1 Incoming supply lines from land-based networks or other external networks to the
installations of the onboard network shall have a permanent connection on board in the form of
fixed terminals or fixed plug sockets. The cable connections shall not be subjected to any
pulling load.
9-2.4.5.2 The hull shall be capable of being earthed effectively when the connection voltage
exceeds 50 V. The earthing connection shall be specially marked.
9-2.4.5.3 Means shall be provided to prevent the concurrent operation of the onboard network
generators and the shore network or another external network. A brief period of concurrent
operation shall be permitted when changing from one system to another without a break in
voltage.
9-2.4.5.4 The connection shall be protected against short circuits and overloads.
9-2.4.5.5 The main switchboard shall indicate whether the connection is live.
9-2.4.5.6 Indicator devices shall be installed to enable polarity to be compared, in the case of
direct current, and phase sequence in the case of alternating current, between the connection and
the onboard network.
9-2.4.5.7 A panel on the connection shall indicate:
(i) The measures required to make the connection;
(ii) The types of current and the nominal voltage and, for alternating current, the
frequency.
9-2.4.6 Power supply to other vessels
9-2.4.6.1 When power is supplied to other vessels, a separate connection shall be used.
9-2.4.6.2 If power sockets rated at more than 16 A are used to supply current to other vessels,
steps shall be taken to ensure (for example, by the use of switches or interlocks) that connection
and disconnection can take place only when the line is dead.
9-2.4.6.3 Cables and their connections shall not be subjected to any pulling load.
 ECE/TRANS/SC.3/172/Rev.1
page 67

9-2.4.6.4 Instruction plates shall be affixed to power supply connections and to coupling
devices, stipulating that feeders must be disconnected before vessels are uncoupled.
9-2.4.6.5 The supply to the pushed barges of a convoy shall be controlled by means of
switches installed on the pusher.
9-2.4.6.6 Paragraphs 9-2.4.5.3 - 9-2.4.5.7 shall apply by analogy.
9-2.5 Generators and motors
Generators and motors shall be so installed as to be readily accessible for inspection,
measurements and repairs and as to prevent water and oil from reaching the windings. Terminal
boxes shall be readily accessible, amply dimensioned and sufficiently waterproof. The type of
protection should be in accordance with the table in 9-2.2 above.
9-2.6 Accumulators
9-2.6.1 The accumulators shall be of a construction suitable for use on board a vessel. They
shall be grouped in boxes or trays fitted with grips to facilitate handling. Cell boxes shall be
made of a shock-resistant material that does not easily catch fire and shall be so made as to
prevent any spillage of electrolyte at an inclination of 40E from the vertical.
9-2.6.2 Accumulators shall be so arranged as not to shift with the movements of the vessel.
They shall not be exposed to excessive heat, extreme cold, spray, steam or vapour. Accumulator
batteries shall be installed so as to permit easy access for replacement, topping up and cleaning
of the elements, with a space of not less then 15 mm all around them to allow air to circulate, and
with no more than 1.5 m separating the deck from the plugs in the uppermost bank. If
accumulators are installed on two or more shelves one above the other, at least 50 mm space
shall be left at the front and back of each shelf to allow air to circulate.
Accumulator batteries shall not be installed in the wheelhouse, accommodation or
holds.
This requirement shall not apply to accumulators for portable appliances, or to
accumulators requiring a charging power of less than 0.2 kW.
9-2.6.3 Accumulator batteries requiring a charging power of more than 2 kW (calculated
from the maximum charging current and the nominal voltage of the battery) shall be installed in
a special battery room. If placed on deck, they shall be enclosed in a cupboard or chest.
Accumulator batteries requiring a charging power not exceeding 2 kW may be
installed below decks in a cupboard or chest. They may be installed in the machinery space or
any other well-ventilated place provided that they are protected against falling objects and
dripping water.
Special battery rooms shall be capable of being heated when the temperature inside
them falls below 5 °C.
9-2.6.4 The interior surfaces of all battery rooms, including cupboards, lockers, shelving and
other built-in fixtures, shall be protected against action of the electrolyte by a coat of paint or a
lining made of a material resistant to the electrolyte.
ECE/TRANS/SC.3/172/Rev.1
page 68

9-2.6.5 Provision shall be made for effective ventilation when batteries are installed in a
closed compartment, cupboard or chest. Forced-draught ventilation shall be provided for nickel-
cadmium accumulators requiring a charging power of more than 2 kW and for lead-acid
accumulators requiring more than 3 kW.
The air shall enter at the bottom and be discharged at the top so that the whole of the
battery is swept by the air stream. Ventilation ducts shall not include devices which obstruct the
air flow.
The minimum air throughput for ventilation, in m3/hour, shall be calculated by the
following formula: Q = 0 .11 ⋅ I ⋅ n
where: I represents, in amperes, the maximum charging current (it shall be not less than
one quarter of the maximum current admissible by the charging device);
n represents the number of cells.
9-2.6.6 Where natural ventilation is used, the cross-section of the ducts shall be sufficient for
the required air throughput at an air-flow velocity of 0.5 m/sec. It shall be not less than 80 cm2
for lead batteries and not less than 120 cm2 for alkaline batteries.
9-2.6.7 Where the required ventilation cannot be obtained by natural air flow, an exhauster
fan shall be provided; its motor shall be clear of the gas stream.
Special devices shall be provided to prevent gases from entering the motor.
Fans shall be of a construction and material precluding the production of sparks
through contact between a blade and the fan casing. In addition, the material shall be such as to
dissipate any electrostatic charges. Warning symbols “No naked lights or fires and no smoking”
corresponding to sketch 2 of appendix 3 with a diameter of at least 10 cm shall be placed on the
doors of rooms or cupboards, or the covers of chests, containing batteries.
9-2.7 Electrical switchboards
9-2.7.1 Switchboards shall be situated in accessible and well-ventilated places and be
protected against water and mechanical damage.
Switchboards shall not be placed near sounding pipes or near the vent pipes of
liquid-fuel tanks.
No pressure pipes shall be situated above the main or emergency switchboard or the
control panels of propulsion equipment. In vessels where this requirement cannot be met, no
pipe joint shall be installed above an electrical switchboard.
9-2.7.2 In general, materials used in the construction of switchboards shall have suitable
mechanical strength and be durable, flame-retardant and self-extinguishing. They shall not be
hygroscopic.
9-2.7.3 Where the voltage exceeds the safe voltage:
(i) The current-carrying components shall be so arranged or protected as to
prevent accidental personal contact;
(ii) An insulating mat or an impregnated wooden grating shall be provided; this
shall not apply, however, to subdistribution panels;
 ECE/TRANS/SC.3/172/Rev.1
page 69

(iii) Metal parts of the frames or substructures of control devices and the metal
casings of appliances shall be carefully earthed.
9-2.7.4 All parts of switchboards, including the connections, shall be readily accessible for
inspection, maintenance or replacement.
9-2.7.5 Marker plates for all circuits shall be affixed to switchboards.
9-2.8 Switches, protective devices
9-2.8.1 Generator circuits and consumer circuits shall be protected against short circuits and
overcurrent on all non-earthed conductors. Overload circuit-breakers or-fuses may be used for
this purpose. Circuits supplying the steering-gear motors (steering installations) and fire pumps
and their control circuits shall only be protected against short circuits. Where circuits include
thermal circuit-breakers these shall be neutralized or set at not less than twice the nominal
amperage and fitted with an emergency warning light indicating overloading.
9-2.8.2 Outputs from the main switchboard to appliances operating at more than 16 A shall
include a load or power switch.
9-2.8.3 Power consumers for the propulsion of the vessel, the steering system, the rudder
position indicator, navigation or safety systems, and appliances with a nominal amperage greater
than 16 A shall be supplied by separate circuits.
9-2.8.4 The circuits of appliances required for propelling and manoeuvring the vessel shall
be supplied directly by the main switchboard.
9-2.8.5 Circuit-breaking equipment shall be selected on the basis of nominal amperage,
thermal or dynamic strength, and their breaking capacity. Switches shall simultaneously cut off
all live conductors. The switching position shall be identifiable.
9-2.8.6 Fuses shall be of the enclosed-melt type and be made of porcelain or an equivalent
material. It shall be possible to change them without any danger of operator contact.
9-2.9 Measuring and monitoring devices
9-2.9.1 Generator, battery and distribution circuits shall be equipped with measuring and
monitoring devices where the safe operation of the installation so requires.
9-2.9.2 Non-earthed networks where the voltage is higher than 50 V, must include an earth-
insulation checking device equipped with a visual and audible alarm. In secondary installations
such as control circuits, this device may be dispensed with.
9-2.10 Emergency circuit breakers
Emergency circuit breakers for oil burners, fuel pumps, fuel separators and engine-room
ventilators shall be installed outside the premises containing the equipment.
9-2.11 Fixed installations
9-2.11.1 Equipment seals shall be sized as a function of the cables to be connected and be
appropriate to the types of cable used.
ECE/TRANS/SC.3/172/Rev.1
page 70

9-2.11.2 Sockets for distribution circuits at different voltages or frequencies shall be

impossible to confuse.
9-2.11.3 Switches shall simultaneously switch off all unearthed conductors within a circuit.
However, single-pole switches within unearthed circuitry shall be permitted in accommodation-
lighting circuits apart from in laundries, bathrooms and washrooms.
9-2.11.4 Where amperage exceeds 16 A it shall be possible to lock the sockets by means of a
switch in such a way that the plug can only be inserted and withdrawn with the power switched
off.
9-2.12 Cables
9-2.12.1 Cables shall be flame-retardant, self-extinguishing and resistant to water and oil. In
accommodation, other types of cable may be used, provided that they are effectively protected,
have flame-retardant characteristics and are self-extinguishing.
9-2.12.2 Cables with conducting wires with a minimum cross-section of 1.5 mm2 shall be
used for power circuits and of 1.0 mm2 for lighting circuits.
9-2.12.3 The armouring and metal sheathing of power and lighting circuits shall not, under
normal operating conditions, be used as conductor wires or earth wires.
9-2.12.4 The armouring and metal sheathing of power and lighting circuits shall be earthed at
least at one end.
9-2.12.5 The cross-section of conductor wires shall take account of the final permissible
maximum temperature of conductor wires (maximum permissible amperage) and permissible
voltage drop. Such a drop between the main switchboard and the furthermost consumer on the
circuit shall not be more than 5 % of nominal voltage for lighting or more then 7 % for power or
heating circuits.
9-2.12.6 Cables shall be protected against mechanical damage.
9-2.12.7 The means of fixing the cables shall ensure that any pulling load remains within the
permissible limits.
9-2.12.8 When cables pass through partitions or decks, the mechanical strength,
watertightness and fire resistance of these partitions and decks shall not be affected by the seals.
9-2.12.9 Cables linking mobile wheelhouses shall be sufficiently flexible and be fitted with
insulation with sufficient flexibility down to -20 °C and resistance to steam and vapour,
ultraviolet rays, ozone, etc.
9-2.13 Lighting
9-2.13.1 In spaces in which accumulators are installed or paint and other highly inflammable
substances are stored, limited-explosion-risk lighting appliances shall be used.
9-2.13.2 Lighting appliances shall be so installed that the heat they emit cannot set fire to
nearby inflammable objects or components.
 ECE/TRANS/SC.3/172/Rev.1
page 71

9-2.13.3 Lighting appliances on open decks shall be so installed as not to impede the
recognition of signal lights.
9-2.13.4 When two or more lighting appliances are installed in the machinery space, as
defined in 1-2, they shall be supplied by at least two different circuits.
9-2.14 Signal lights
9-2.14.1 The switchboards for the signal lights shall be installed in the wheelhouse. They
shall be supplied by a separate feeder from the main switchboard or by two separate secondary
networks.
9-2.14.2 Lights shall be individually supplied from the lighting panel and be individually
protected and controlled.
9-2.14.3 Tell-tale lamps or other equivalent devices monitoring the signal lights shall be
placed on the switchboard in the wheelhouse. No fault in the monitoring installation mentioned
in 7-1.6 shall affect the operation of the light which it monitors.
9-2.14.4 Several lights forming a functional unit and installed together at the same point may
be jointly supplied, controlled and monitored. The monitoring installation shall be capable of
identifying the failure of any of these lights. However, it shall not be possible to use both light
sources in a double light (two lights mounted one above the other or in the same housing)
simultaneously.
9-2.15 Earthing
9-2.15.1 Electrical equipment operating at a voltage of more than 50 V needs to be earthed.
9-2.15.2 Metal parts of electrical equipment that are not electrically live and can be touched
by people, such as machinery frames and casings, appliances and lighting equipment, shall be
earthed separately where these are not in electrical contact with the hull as a result of their
installation.
9-2.15.3 The housings of mobile electrical consumers and portable appliances shall be earthed
by means of an additional conductor that is incorporated into the power cable.
That prescription does not apply where a circuit-separation transformer is used, nor
to appliances fitted with protective insulation (double insulation).
ECE/TRANS/SC.3/172/Rev.1
page 72

9-2.15.4 The cross section of the earthing conductors shall be not less than as set out in the
table below:
&URVVVHFWLRQRIRXWVLGH 0LQLPXPFURVVVHFWLRQRIHDUWKLQJFRQGXFWRUV
FRQGXFWRUV LQLQVXODWHGFDEOHV ILWWHGVHSDUDWHO\
PP  PP  PP 

IURPWR VDPHFURVVVHFWLRQDVWKDWRIWKH 
RXWVLGHFRQGXFWRU
PRUHWKDQWR VDPHFURVVVHFWLRQDVWKDWRIWKH VDPHFURVVVHFWLRQDVWKDWRIWKH
RXWVLGHFRQGXFWRU RXWVLGHFRQGXFWRU
PRUHWKDQWR  
PRUHWKDQWR KDOIRIWKHFURVVVHFWLRQRIWKH KDOIRIWKHFURVVVHFWLRQRIWKH
RXWVLGHFRQGXFWRU RXWVLGHFRQGXFWRU
PRUHWKDQ  

9-2.16 Emergency source of electric power

9-2.16.1 (i) Every vessel navigating in zone 1 shall be equipped with an emergency source
of electric power.
(ii) Every passenger vessel navigating in zones 2 and 3 shall be equipped with an
emergency source of electric power.
The Administration may prescribe more detailed requirements concerning
emergency source of electric power, depending on the type and purpose of the vessel.
9-2.16.2 If a vessel navigating in zones 2 and 3, other than a passenger vessel not less than
25 m in length, is equipped with two or more independent sources of power, one of them may be
accepted as an emergency source of power.
9-2.16.3 The emergency source of power may be:
(i) Either an auxiliary set whose fuel supply system and cooling system are
independent of the main machinery, and which is automatically started and
connected to the network as soon as the voltage falls on the bus-bars of the
main switchboard. The electric power shall be supplied within 30 seconds
after the failure of the main electricity supply. The Administration or a
recognized Classification Society may permit manual starting if the auxiliary
set is installed in the immediate vicinity of a station which is permanently
manned and which is outside the machinery space;
(ii) Or an accumulator battery automatically taking up current-supply duty in a
network failure and capable of meeting the requirements of paragraph 9-2.16.5
for the prescribed time without having to be recharged and without a voltage
drop exceeding that authorized. The Administration or a recognized
Classification Society may permit manual switching on from a station which is
permanently manned and which is outside the machinery space.
On passenger vessels, power for emergency lighting shall be supplied within seven
seconds.
 ECE/TRANS/SC.3/172/Rev.1
page 73

9-2.16.4 The emergency source and its switchboard shall be installed:

(i) On vessels navigating in zone 1, above the freeboard deck and outside the
machinery space;
(ii) On passenger vessels not less than 25 m in length, navigating in zones 2 and 3,
above the freeboard deck, outside the machinery space, the spaces housing the
power sources referred to in 9-1.2.1, and the space where the main switchboard
is located. The location shall be separated from these spaces by watertight
partitions that are fire-resistant according to 15-11.2. If the vessel is less than
25 m in length, the emergency source may be installed in the machinery space,
as high up as possible;
(iii) On all other vessels navigating in zones 2 and 3, as high up as possible.
If the space housing the emergency source is situated below the freeboard deck, that
space shall be accessible from the deck.
The emergency source of power shall not be installed forward of the collision
bulkhead.
9-2.16.5 The capacity of the emergency source shall be sufficient to supply all consumers
necessary to the safety of all persons on board, due account being taken of consumers which may
be required to operate simultaneously. At least the following, if their use is prescribed, and if
they each have no independent emergency source of power, shall be supplied simultaneously
(i) Navigation and signal lights;
(ii) Emergency lighting;
(iii)Alarm and safety systems;
(iv) Intercommunication systems;
(v) Radio and telephone equipment;
(vi) Emergency floodlight;
(vii)Controls of fixed fire-fighting installations;
(viii)
Fire pump and emergency pump (on passenger vessels) where the auxiliary set
as mentioned in 9-2.16.3 (i) is used;
(ix) Emergency steering gear;
(x) The rudder position indicator.
The length of time for which the emergency source of power shall be required to
supply the prescribed consumers shall be fixed according to the vessel's purpose, but shall not be
less than 30 minutes.
9-2.16.6 At least the following places and stations shall be provided with sufficient
emergency lighting:
(i) Places where collective life-saving appliances are stored, handled and
launched;
(ii) Accommodation exists and passages;
(iii) Machinery space and its exits;
(iv) The emergency switchboard;
ECE/TRANS/SC.3/172/Rev.1
page 74

(v) The wheelhouse (with provision for disconnection);

(vi) The space housing the emergency source of power;
(vii) Fire-fighting stations;
(viii) Emergency assembly stations for passengers and crew.
The intensity of the emergency lighting shall be prescribed by the Administration.
9-2.17 Alarm and safety systems
The alarm and safety systems for monitoring and protecting mechanical equipment
shall meet the following requirements:
9-2.17.1 Alarm systems
The alarm systems shall be so designed that no failure in the alarm system can result
in failure of the apparatus or equipment being monitored. Visual alarms shall remain visible
until the fault has been remedied; an alarm with acknowledgement shall be distinguishable from
an alarm without acknowledgement. Each alarm shall also comprise an audible warning. It shall
be possible to switch off acoustic alarms. Switching off one acoustic alarm shall not prevent
another signal from being set off by another cause. Exceptions shall be permitted in the case of
alarm systems comprising less than 5 measurement points.
9-2.17.2 Safety systems
Safety systems shall be designed to halt or slow down the operation of the affected
equipment, or to warn a permanently-manned station to do so before a critical state is reached.
Binary transmitters shall be designed according to the load-current principle. If safety systems
are not designed to be self-monitoring their operation must be checkable. Safety systems must
be independent of other systems.
9-2.18 Electronic equipment
9-2.18.1 General
The test conditions in 9-2.18.2 below shall apply only to electronic devices and their
ancillaries on the steering system and the vessel’s power plants.
9-2.18.2 Test conditions
(i) The stresses arising from the test shall not cause electronic devices to be
damaged or to malfunction. The tests in accordance with the international
standards, such as publication IEC 92-504 concerning these, shall be carried
out with the device in operation, apart from the cold-proofing test;
(ii) Variations in voltage and frequency
 3DUDPHWHU 9DULDWLRQV
FRQWLQXRXV VKRUWGXUDWLRQ
*HQHUDO )UHTXHQF\ “ “V

 9ROWDJH “ “V

%DWWHU\RSHUDWLRQ YROWDJH “ 

 ECE/TRANS/SC.3/172/Rev.1
page 75

(iii) Heating test

The sample is brought up to a temperature of 55 °C within a half-hour period.
After that temperature has been achieved it is maintained for 16 hours. An
operating test is then conducted.
(iv) Cold-condition test
The sample is shut down and cooled to -25 °C and held at that temperature for
two hours. The temperature is then raised to 0 °C and an operating test is
conducted.
(v) Vibration test
The vibration test shall be carried out along the three axes at the resonance
frequency of the appliances or parts for the period of 90 minutes in each case.
If no clear resonance emerges the vibration test takes place at 30 Hz. The
vibration test takes place via sinusoidal oscillation within the following limits:
General:
f = 2.0 − 13.2 Hz; a = ± 1mm
(amplitude a = 1/2 the vibration width)

f = 13.2 Hz − 100 Hz; acceleration ± 0.7 g .

Equipment intended to be fitted to diesel engines or steering system shall be
tested as follows:
f = 2.0 − 25 Hz; a = ± 1.6 mm
(amplitude a = 1/2 the vibration width)
f = 25 Hz − 100 Hz; acceleration ± 4 g .
The sensors intended to be installed in diesel-engine exhaust pipes may be
exposed to considerably higher stresses. Account shall be taken of this during
the tests.
(vi) The electromagnetic compatibility test shall be carried out on the basis of
IEC publications 801-2, 801-3, 801-4, 801-5 at test degree number 3.
(vii) Proof that the electronic equipment is adequate for these test conditions shall
be provided by their manufacturer. A certificate by a Classification Society is
likewise considered to be proof.
9-2.19 Electromagnetic compatibility
The operation of the electric and electromagnetic systems shall not be impaired by
electromagnetic interference. General accompanying measures shall concentrate on:
(i) Disconnection of the transmission paths between the source of interference and
the user appliances;
(ii) Reducing the causes of disturbance at their source;
(iii) Reducing the sensitivity of the consumer appliances.
 ECE/TRANS/SC.3/172/Rev.1
page 77

CHAPTER 10
EQUIPMENT
10-1 ANCHOR AND MOORING EQUIPMENT
10-1.1 General
10-1.1.1 Vessels shall be provided with anchor equipment according to their type and size and
to the waterways on which their use is intended for.
10-1.1.2 Cast iron anchors shall not be permitted.
10-1.1.3 For anchors with increased holding power the Administration may reduce the mass
calculated according to 10-1.2 and 10-1.3.
10-1.2 Bow anchors
10-1.2.1 Vessels intended for the carriage of goods, apart from ship-borne barges whose
length L does not exceed 40 m, shall be equipped with bow anchors whose total mass P is
obtained using the following formula:
P = k . B . T [kg]
Where k is a coefficient that takes account of the relationship L
between length L and breadth B, and of the type of k =c
8⋅B
vessel:
for pushed barges, however, k = c will be taken;
c is an empirical coefficient given in the following table:
Deadweight tonnage in t Coefficient c
up to 400 inclusive 45
from 400 to 650 inclusive 55
from 650 to 1 000 inclusive 65
more than 1 000 70

Passenger vessels and vessels not intended for the carriage of goods including
pushers shall be equipped with bow anchors whose total mass P in kg is calculated according to
the formula and the table stated above, using the water displacement in cubic meters instead of
the deadweight tonnage.
10-1.2.2 For basins where the current velocity does not exceed 6 km/h, the anchor equipment
of vessels shall be assigned according to the equipment number N in m2 calculated according to
the formula:
N = LWL (BWL + H) + k™lh
where: k is the coefficient taken equal to 1.0 for vessels for which the total length of
superstructures and deckhouses on all decks exceeds half of the vessel’s length,
and equal to 0.5 for vessels for which the above-mentioned length is within
0.25 to 0.5 of the vessel’s length. When the total length of superstructures and
deckhouses is less than 0.25 of the vessel’s length, superstructures and
deckhouses may be dispensed with for the equipment number calculations;
ECE/TRANS/SC.3/172/Rev.1
page 78

l is the length of individual superstructures and deckhouses in m;

h is the average height of individual superstructures and deckhouses in m.
For vessels intended to carry cargo on deck the value of the parameter ™lh shall be
calculated as the product of the lateral projection length of the cargo stowed on the
deck together with cargo limiting structures and its average height, and coefficient k
shall be taken as 0.5 for vessels intended to carry only loose cargoes in bulk, and 1.0
for vessels intended to carry other deck cargoes.
The mass of bow anchors P in kg shall be not less than:
(i) For vessels having the equipment number N up to 1000 m2:
P = KN;
(ii) For vessels having the equipment number N = 1000 m2 and over:
P = KN (1000 » N)0.2,
Where K is the coefficient, generally taken equal to 1.0. However, the Basin
administration may assign other value of this coefficient depending on the
navigation conditions.
10-1.2.3 Where two bow anchors are provided, their masses shall be equal to each other or
differ by not more then 10 %.
10-1.3 Stern anchors
10-1.3.1 Vessels shall be equipped with stern anchors whose total mass is equal to 25 % of
mass P calculated in accordance with 10-1.2.1.
Vessels with a maximum length over 86 meters shall be equipped with stern anchors
of total mass equal to 50 % of mass P calculated in accordance with 10-1.2.1.
Stern anchors are not required for:
(i) Vessels for which the stern anchor mass will be less than 150 kg;
(ii) Pushed barges.

10-1.3.2 Vessels intended to push convoys not more than 86 m in length shall be equipped
with stern anchors whose total mass is equal to 25 % of mass Ɋ calculated in accordance with
10-1.2.1 for the largest formation (considered to be a nautical unit) permitted and entered in the
ship’s certificate.
Vessels intended to push rigid convoys that are longer than 86 m downstream shall
be equipped with stern anchors whose total mass is equal to 50 % of mass Ɋ calculated in
accordance with 10-1.2.1 for the largest formation (considered to be a nautical unit) permitted
and entered in the ship’s certificate.
10-1.3.3 For basins where the current velocity is below 6 km/h, the total mass of stern anchors
shall be similarly calculated as in 10-1.3.1 and 10-1.3.2, in accordance with the mass P
calculated in 10-1.2.2.
 ECE/TRANS/SC.3/172/Rev.1
page 79

10-1.4 Chains and cables

10-1.4.1 Each bow anchor chain shall have a minimum length of:
• 40 m for vessels not exceeding 30 m in length;
• 10 m greater than the vessel’s length where the vessel’s length is between
30 and 50 m;
• 60 m for vessels more than 50 m in length.
10-1.4.2 Each of the stern anchor chains shall be at least 40 m long. However, where vessels
need to stop facing downstream they shall have stern anchor chains that are each at least 60 m in
length.
10-1.4.3 Anchor chains shall have a sufficient tensile strength.
10-1.4.4 The use of cables instead of anchor chains is permitted. In this case the cable shall
be connected to the anchor by means of a chain with a length sufficient for securing the anchor
in its stowed position by means of a chain stopper. The cables shall have the same tensile
strength as that required for chains and shall be 20 % longer.
10-1.4.5 Vessel shall be equipped with three mooring cables, the minimum lengths of which,
in m, shall be as follows:
• First cable: L + 20, but not more than 100;
• Second cable: two thirds of the first cable;
• Third cable: one third of the first cable.
On vessel where L is less than 20 m, the third cable shall not be required.
Cables shall be made of steel, natural or synthetic fibre and have a sufficient tensile
strength.
10-1.5 Anchor handling and mooring equipment
10-1.5.1 Vessels shall be provided with all necessary fittings and equipment needed for
dropping and lifting the anchors, riding at anchor, pulling the vessel to the mooring facilities and
its reliable fixing to them. If the mass of an anchor is 50 kg or more, the vessel shall be provided
with a windlass or a winch for lifting it.
10-1.5.2 The fittings and their fastenings to the hull shall be strong enough to withstand a
pulling load at least equal to the breaking load of the chains or cables for which they are
intended.
10-1.5.3 The chain lockers shall be of sufficient capacity to contain the whole of the anchor
chain without difficulty.
10-1.5.4 Each anchor chain or cable shall be securely attached at its end to a reinforced part of
the hull. The attachment shall incorporate a release device.
ECE/TRANS/SC.3/172/Rev.1
page 80

10-2 MISCELLANEOUS EQUIPMENT

10-2.1 All manned vessels shall be provided with at least the following equipment:
• The appliances and devices needed for the emission of visual and acoustic
signals and for marking the vessel;
• Spare lamps for the navigation lights or an emergency power source for the
navigation lights;
• A pair of ship's binoculars;
• A loud-hailer;
• A gangway at least 0.4 m wide and 4 m long, fitted with a hand-rail; the
competent authority on inspection of vessels may permit shorter gangways for
small vessels;
• A sounding device;
• A boathook;
• A suitable equipment for stopping minor leaks;
• A first-aid kit with content in accordance with a relevant standard of the
Administration kept in an accommodation room or in the wheelhouse and
stored in such a way that it is easily and safely accessible if necessary. If the
first-aid kit is stored concealed the cover shall be marked by a symbol for first-
aid kit, having a side length of at least 10 cm;
• A notice concerning the rescue of men overboard;
• Two heaving-lines;
• Radio telephone system.
10-2.2 In addition to the requirements of 10-2.1, manned vessels navigating in zone 2 shall
be provided with:
• A fixed compass;
• Availability of nautical charts;
• An echo sounder or a sounding lead.
10-2.3 In addition to the requirements of 10-2.1 and 10-2.2 manned vessels navigating in
zone 1 shall be provided with:
• Spare lamps for the navigation lights;
• A radio set for receiving weather reports;
• A chronometer at the steering station;
• A pilot-ladder;
• Covers for windows, skylights and other openings which may let in water.
 ECE/TRANS/SC.3/172/Rev.1
page 81

10-3 FIRE-FIGHTING APPLIANCES

10-3.1 There shall be at least:
(i) In the wheelhouse: 1 portable fire extinguisher;
(ii) Close to each means of access from the 1 portable fire extinguisher;
deck to the accommodation:
(iii) Close to each means of access to service 1 portable fire extinguisher;
premises that are not accessible from the
accommodation, and which contain
heating, cooking or refrigerating equipment
using solid or liquid fuels or liquefied gas:
(iv) At each entrance to the engine room and 1 portable fire extinguisher;
boiler rooms:
(v) At suitable points below deck in engine 1 portable fire extinguisher.
rooms and boiler rooms such that no
position in the space is more than 10 metres
walking distance away from an
extinguisher:

10-3.2 The extinguishers shall be suitable for their purpose and shall meet the requirements
of the Administration or recognized Classification Society. They shall be inspected and checked
at least once every two years. A certificate to that effect, signed by the firm or person that
carried out the inspection, shall be kept on board.
10-3.3 The extinguishing substance may neither be halon nor contain a product which is
likely to release toxic gases, such as carbon tetrachloride during use. Portable fire extinguishers
using CO2 may only be used to fight fires at specific locations such as electrical installations,
kitchens; the quantity of CO2 shall not constitute a health hazard.
10-3.4 Extinguishers sensitive to frost or heat shall be installed or protected in such a
manner that they are always ready for use.
10-3.5 If the fire-fighting appliances are so installed as to be concealed from view, the plates
or doors concealing them shall bear a symbol corresponding to relevant sketches of appendix 3
with a side length of at least 10 cm.
10-3.6 Fixed fire-extinguishing installations shall meet the requirements of the
Administration or of a recognized Classification Society. The use of halon is not authorized.
The equipment shall be checked at least every two years by an approved expert. The dated
inspection certificates, signed by the inspector involved, shall be kept on board.
10-3.7 In addition to the above provisions of this chapter, all vessels intended for navigation
in zone 1 shall be provided with fire pumps, pressure piping for fire-extinguishing water, and fire
hydrants and hoses. The equipment shall meet the requirements of the Administration or
recognized Classification Society.
ECE/TRANS/SC.3/172/Rev.1
page 82

10-3.8 In addition to the above provisions of this chapter, vessels with a length of 110 m or
more and intended for navigating in zone 1 shall have a fixed fire-extinguishing installation
installed in:
(i) Rooms in which main or auxiliary oil-fired boilers are installed and rooms
containing fuel pumps or settling tanks;
(ii) Rooms containing internal combustion engines constituting the main means of
propulsion or used as auxiliary machinery with the installed total capacity of
not less than 750 kW.

10-4 HOISTING GEAR, RIGGING AND EQUIPMENT

10-4.1 Masts fitted with hoisting gear
10-4.1.1 Masts for supporting derricks shall be made of standardized material or materials
approved by a recognized Classification Society.
10-4.1.2 The masts shall be suitably fixed to the vessel and shall be built to adequate
scantlings, account being taken of the maximum load on the derricks they are intended to
support.
10-4.2 Derricks and other hoisting gear
10-4.2.1 Hoisting gear (including masts and derricks) and all fixed or movable fittings used on
board for loading or unloading shall comply with the requirements of the Convention concerning
Occupational Safety and Health in Dock Work 1979 (Convention No. 152) adopted by the
International Labour Office.
10-4.2.2 Hoisting gear other than mentioned in 10-4.2.1 shall meet the requirements of the
Administration.

10-5 LIFE-SAVING APPLIANCES

10-5.1 Collective life-saving appliances
10-5.1.1 General requirements
10-5.1.1.1 Collective life-saving appliances shall:
(i) Carry an indication of the use and of the number of persons for which they are
approved;
(ii) Have and maintain a stable trim if grabbed by the indicated number of persons;
(iii) Be fitted with a line securely fastened round the outside perimeter enabling
them to be grabbed by persons being in water;
(iv) Be made of a suitable material and be resistant to oil and oil products, and to
temperatures of up to 50 °C;
(v) Have a fluorescent orange colour or have permanently fixed fluorescent
surfaces measuring at least 100 cm2;
(vi) Be rapidly and safely launchable from their place of storage by a single person;
(vii) Be checked in accordance with manufacturer’s instructions.
 ECE/TRANS/SC.3/172/Rev.1
page 83

10-5.1.1.2 Inflatable life-saving appliances shall in addition to 10-5.1.1.1:

(i) Comprise at least two separate air compartments;
(ii) Inflate automatically or by manual command when launched;
(iii) Have and maintain a stable trim whatever load it is supporting, even with only
half of the air compartments inflated;
(iv) Be checked in accordance with the manufacturer’s instructions.
10-5.1.2 Lifeboats
10-5.1.2.1 All lifeboats shall be well designed and of such shape and proportions that they have
ample stability and sufficient freeboard when carrying their full load of persons and equipment.
10-5.1.2.2 All lifeboats shall be strong enough to be lowered into the water with complete
safety when carrying their full load of persons and equipment. They shall be of such strength
that they will not suffer permanent deformation if subjected to an overload of 25 %.
10-5.1.2.3 Every lifeboat shall meet the following requirements:
(i) It shall be equipped with seats sufficient for at least three persons;
(ii) The number of persons whom the lifeboat is permitted to carry shall be
determined according to its cubic capacity as calculated by the recognized
methods, on the basis of not less than 0.225 m3 per person. The seating
capacity of the lifeboat shall be determined by tests to find out how many
adults wearing lifejackets can be accommodated without interfering with the
rowing and steering of the lifeboat;
(iii) The lifeboat stability shall be adequate for the maximum number of persons it
may carry; its stability shall be deemed to be adequate if, with half the
maximum permissible number of persons seated on one side of the lifeboat,
there remains a freeboard of not less than 100 mm;
(iv) There shall be a seat width of not less than 0.45 m per person;
(v) The lifeboat shall remain sufficiently buoyant and sufficiently stable when
carrying its full load of persons and equipment and filled with water.
10-5.1.2.4 The lifeboat equipment shall meet the requirements of the Basin administration or a
recognized Classification Society.
10-5.1.3 Liferafts
10-5.1.3.1 Every liferaft shall be fitted with devices for mooring and towing.
10-5.1.3.2 Every liferaft shall be so constructed as to comprise units containing a volume of air
of at least 0.096 m3 (or equivalent buoyancy devices in the case of rigid liferafts), and a deck
area of at least 0.372 m2, for every person it is permitted to carry.
10-5.1.3.3 The liferaft shall be so constructed that if it is dropped into the water from a height of
10 metres, neither the liferaft nor its equipment will be damaged.
ECE/TRANS/SC.3/172/Rev.1
page 84

10-5.1.3.4 Liferaft equipment shall comply with the requirements of the Basin administration or
a recognized Classification Society.
10-5.1.3.5 Inflatable liferafts are in addition to paragraphs 10-5.1.3.1 - 10-5.1.3.4 to meet the
following requirements:
(i) Every inflatable liferaft shall be so designed that, when fully inflated and
floating, it is stable in the water;
(ii) The liferaft shall be capable of being easily righted by one person in the water
if it inflates upside down;
(iii) The liferaft shall be fitted with appropriate means of enabling persons in the
water to climb on board;
(iv) The liferaft shall be packed in a valise or container capable of withstanding
hard wear and use; the liferaft in its valise or container shall float in such a way
as to permit the immediate operation of the inflation system.
10-5.1.3.6 Rigid liferafts shall in addition to paragraphs 10-5.1.3.1 - 10-5.1.3.4 meet the
following requirements:
(i) Rigid liferaft shall be so constructed as to retain its shape in all weather
conditions, on deck and in the water;
(ii) The deck area of the liferaft shall be situated within that part of the liferaft
which affords protection to its occupants. The nature of the deck shall be such
as to prevent so far as practicable the ingress of water and it shall effectively
hold the occupants out of the water;
(iii) The equipment of the liferaft shall be so stowed as to be readily accessible
whichever way up the liferaft is floating.
10-5.1.4 Ship’s boats
10-5.1.4.1 Ship’s boats may be used as a collective life-saving appliance if complying with the
requirements of 10-5.1.1.
10-5.1.4.2 The ship’s boats shall meet the following requirements:
(i) They shall be easy to steer and manoeuvre, they shall maintain their course and
not drift significantly under the effect of the wind, the current or the waves;
(ii) They shall have seats for at least three persons;
(iii) They shall be sufficiently resistant;
(iv) Their volume shall be at least 1.5 m3, or the product of Lɋ x ȼC x HC shall
represent at least 2.7 m3;
(v) Their freeboard shall be at least 25 cm with three persons of approximately
75 kg each on board;
(vi) They shall be adequately stable. This shall be considered adequate if there is a
residual freeboard of at least 10 cm when two persons of roughly 75 kg each
are on one side as close as possible to the gunwale;
 ECE/TRANS/SC.3/172/Rev.1
page 85

(vii) Their buoyancy in N with no passengers on board, but completely filled with
water, shall be at least equal to 300 Â Lɋ Â ȼɋ Â HC;
(viii) The following gear shall be on board:
• One set of oars;
• One mooring rope;
• One bailer.
10-5.1.4.3 It shall be possible for one person to launch such ship’s boats safely. If a power-
driven unit is used for launching it should be ensured that a failure of the power supply will not
jeopardize rapid and safe launching.
10-5.1.4.4 Inflatable ship’s boats shall be permitted provided the conditions set out in
paragraphs 10-5.1.4.2 and 10-5.1.4.3 are met, that they are permanently operational and that they
have several compartments.
10-5.1.4.5 If a ship’s boat is used on a passenger vessel as a lifeboat it shall at least meet the
conditions set out in paragraph 10-5.1.4.2. However,
(i) Seat width shall be at least 0.45 m per person, while the maximum permissible
number of persons shall not exceed the product of 3 Â Lɋ Â ȼɋ Â HC;
(ii) Their stability shall be considered adequate if there is a freeboard of at least
10 cm when half of the maximum number of passengers permitted are
positioned on one side of the ship’s boat.
Note: In paragraphs 10-5.1.4.2 and 10-5.1.4.5:
Lɋ is the ship’s boat length in metres;
ȼɋ is the ship’s boat width in metres;
HC is the ship’s boat depth in metres.
10-5.1.5 Life-saving buoyancy aids
Life-saving buoyancy aids shall provide a buoyancy of at least 100 N (Newton) per
person in fresh water.
10-5.2 Individual life-saving appliances
10-5.2.1 General requirements
Individual life-saving appliances shall meet the following requirements:
(i) To provide a buoyancy of at least 100 N in fresh water;
(ii) To be made of a suitable material and be resistant to oil and oil products, and to
temperatures of up to 50 °C;
(iii) Have a fluorescent orange colour or have permanently fixed fluorescent
surfaces measuring at least 100 cm2;
(iv) To be capable of supporting an iron load of 7.5 kg in fresh water for 24 hours.
ECE/TRANS/SC.3/172/Rev.1
page 86

10-5.2.2 Lifejackets
10-5.2.2.1 A lifejacket shall satisfy the following requirements:
(i) It shall be capable of keeping the head of an exhausted or unconscious person
above water;
(ii) It shall be so designed as to eliminate so far as possible all risk of its being put
on incorrectly; however, it shall be capable of being worn inside out;
(iii) It shall be capable of turning the wearer's body, on entering the water, to a safe
floating position slightly inclined backwards from the vertical;
(iv) It shall be easy and quick to put on, and shall fasten securely to the body.

10-5.2.2.2 Inflatable life jackets shall inflate automatically and manually and may also be
inflated by mouth. They shall be checked in accordance with the manufacturer’s instructions.
10-5.2.2.3 Inflatable lifejackets shall meet the requirements of the Basin administration.
10-5.2.3 Lifebuoys
10-5.2.3.1 Lifebuoys shall meet the following requirements:
(i) Have a mass of not less than 2.5 kg;
(ii) Have an internal diameter of 0.45 m ± 10 %;
(iii) Be encircled with rope which can be grasped.
10-5.2.3.2 At least one lifebuoy on each side of the vessel shall be fitted with a reliably secured
buoyant lifeline which is not less than 25 m long.
10-5.3 Stowage and handling of life-saving appliances
10-5.3.1 Life-saving appliances shall be stored on board in such a way that in case of need it
can be easily and safely reached. Concealed storage places shall be clearly signed.
10-5.3.2 The lifeboat launching devices - davits, falls, blocks and other gear - shall be of such
strength that the lifeboats can be safely lowered on either side in unfavourable conditions of list
or trim.
10-5.3.3 All collective life-saving appliances shall be so stowed that they can be launched as
quickly as possible.
10-5.3.4 The lifebuoys shall be ready for use and located on deck at suitable places, but shall
not be fastened into their holders. At least one lifebuoy shall be placed in the immediate vicinity
of the wheelhouse.
10-5.3.5 Where necessary, equipment should be provided to pull launchable collective life-
saving appliances towards the side of the vessel and restrain them in that position to facilitate
safe embarkation.
 ECE/TRANS/SC.3/172/Rev.1
page 87

10-5.4 Number and capacity of life-saving appliances

10-5.4.1 General
In general, all vessels shall be provided with life-saving appliances appropriate to the
navigation zone, as specified below.
10-5.4.2 Vessels navigating in zone 1
10-5.4.2.1 Vessels navigating in zone 1 shall have:
(i) • Either on each side of the vessel, one or more lifeboats of sufficient
aggregate capacity to accommodate all persons on board;
• Or one or more lifeboats capable of being launched on either side of the
vessel and of sufficient aggregate capacity to accommodate all persons on
board;
• Or ship’s boat and, on each side of the vessel, one or more liferafts of
sufficient aggregate capacity to accommodate all persons on board;
(ii) One or more liferafts of sufficient aggregate capacity to accommodate half the
total number of persons on board;
(iii) A sufficient number of lifejackets for all persons on board;
(iv) At least four lifebuoys, of which at least two shall be equipped with a source of
light if the vessel travels at night.
10-5.4.2.2 Vessels navigating in zone 1 need not be equipped with liferafts provided that they
are equipped with lifeboats in accordance with paragraph 10-5.4.2.1, subparagraph (i), first item
above.
10-5.4.3 Vessels navigating in zones 2 and 3
Vessels navigating in zones 2 and 3 shall have:
(i) Collective life-saving appliances conforming in number and capacity to the
requirements of the Basin administration or a recognized Classification
Society;
(ii) A sufficient number of lifejackets for all persons on board;
(iii) At least three lifebuoys for smaller vessels, although two lifebuoys may be
allowed by the Basin administration. At least one of these buoys shall be
equipped with a source of light if the vessel travels at night.
These provisions shall not apply to unmanned vessels such as pushed barges.
10-5.5 Carriage of ship’s boats
The following vessels shall carry a ship’s boat:
(i) Self-propelled vessels and manned towed barges of more than 150 tonne dwt;
(ii) Tugs and pushers of more than 150 m3 water displacement;
(iii) Floating equipment;
(iv) Passenger vessels.
 ECE/TRANS/SC.3/172/Rev.1
page 89

CHAPTER 11
WORKING SPACES
11-1 GENERAL
11-1.1 Vessels shall be built, arranged and equipped in such a way as to enable the crew to
work and move about safely.
11-1.2 The necessary on-board working facilities including permanent fixtures shall be
arranged, laid out and protected in such a way as to permit safe, easy movement on board, and
maintenance. If necessary, moving parts of machinery and hot parts of installations shall be
provided with the means to protect people.

11-2 PROTECTION AGAINST FALLING

11-2.1 Decks including side decks and wherever people walk and work shall be free from
obstacles likely to cause tripping and it shall be impossible for puddles to remain.
11-2.2 Decks including side decks, engine-room floors, landings, companionway steps and
the tops of bollards shall be designed to prevent slipping.
11-2.3 The tops of side deck bollards and obstacles in passageways, such as the edges of
steps, shall be painted in a colour contrasting with the surrounding decks.
11-2.4 The outer edges of decks, as well as working spaces where people might fall more
than 1 metre, shall be fitted with bulwarks or coamings or with a guard rail, which shall comprise
a handrail at least 0.90 m high, a rail at knee height and a foot-rail. Coamings may be fitted with
a hand-rail only. Coaming hand-rails shall not be required where side decks are fitted with non-
retractable guard rails.

11-3 DIMENSIONS OF WORKING SPACES

Working spaces shall be large enough to provide every person working in them with
adequate freedom of movement.
11-4 SIDE DECK
11-4.1 The clear width of the side deck shall be at least 0.60 m. That figure may be reduced
to 0.5 m at certain positions where necessary installations are located such as deck-swabbing
cocks and to 0.4 m at bollard emplacements.
11-4.2 Up to a clear height of 0.90 m above the side deck, the clear width of the side deck
may be reduced to 0.54 m provided that the clear width above, between the outer edge of the hull
and the inner edge of the hold, is not less than 0.65 m. However, the clear width of the side deck
may be reduced to 0.50 m if the outer edge of the side deck is fitted with a guard rail in
accordance with paragraph 11-2.4 to prevent falling. On vessels of 55 m or less in length the
guard rail may be dispensed with provided that the safety conditions are deemed satisfactory by
the Administration.
11-4.3 The requirements of 11-4.1 and 11-4.2 shall apply up to a height of 2.00 m above the
side deck.
ECE/TRANS/SC.3/172/Rev.1
page 90

11-5 ACCESS TO WORKING SPACES

11-5.1 Points of access and passageways for the movement of people and objects shall be of
sufficient size and so arranged that:
(i) In front of the access opening, there is sufficient room not to impede
movement;
(ii) The clear width of the passageway shall be appropriate for the intended use of
the working space and shall be not less than 0.60 m, except in the case of
vessels less than 8 m wide, where it may be reduced to 0.50 m;
(iii) The height of the access opening including the coaming, if any, is not less than
1.90 m.
11-5.2 Doors shall be so arranged that they can be opened and closed safely from both sides.
They shall be protected against accidental opening or closing.
11-5.3 Stairs, ladders or steps shall be installed in accesses, exits and passageways where
there is more than a 0.50 m difference in floor level.
11-5.4 Working spaces which are manned continuously shall be fitted with stairs if there is a
difference in floor level of more than 1 m. This requirement shall not apply to emergency exits.
11-5.5 Vessels equipped with holds shall have at least one fixed ladder in each hold which
can be used to enter and leave the hold safely. This requirement shall not apply where two
movable hold ladders are provided.

11-6 EXITS AND EMERGENCY EXITS

11-6.1 The number, arrangement and dimensions of exits, including emergency exits, shall
be in accordance with the use and dimensions of the relevant space. Where one of the exits is an
emergency exit, it shall be clearly marked as such.
11-6.2 Emergency exits or windows, portholes or skylights serving as emergency exits shall
have a clear opening of not less than 0.36 m2, and the smallest dimension shall be not less than
0.50 m.
11-7 STAIRS, LADDERS AND STEPS
11-7.1 Stairs and fixed ladders shall be securely attached to the vessel structures.
11-7.2 Stairs shall be not less than 0.60 m wide; steps shall be not less than 0.15 m deep and
not more than 0.3 m high; steps shall have non-slip surfaces and stairs with more than three steps
shall be fitted with hand-rails. The clear width between hand-rails shall be not less than 0.60 m.
11-7.3 Fixed ladders and climbing steps shall have a clear width of not less than 0.30 m;
step height shall be not more than 0.30 m and the distance from the centre of the step to the
vessel structures shall be not less than 0.15 m.
11-7.4 Fixed ladders and climbing steps shall be clearly identifiable as such from above and
shall be equipped with safety handles above exit openings.
 ECE/TRANS/SC.3/172/Rev.1
page 91

11-7.5 Portable ladders shall be at least 0.40 m wide, and at least 0.50 m wide at the base; it
shall be possible to ensure that they will not topple or skid; the rungs shall be securely fixed in
the uprights.
11-7.6 Portable ladders used as hold ladders shall, with a 60° incline, extend to at least 1 m
above the deck and in any event above the upper edge of the hatchway coaming.
11-8 INSIDE SPACES
11-8.1 The dimensions, arrangement and layout of inside working spaces shall be in
accordance with the work to be carried out and shall meet the national health and safety
requirements of the Administration. They shall be equipped with adequate non-dazzle lighting
and with ventilation arrangements; if necessary, they shall be fitted with heating appliances
capable of maintaining an adequate temperature.
11-8.2 The floors of inside working spaces shall be solid and durable, and shall be designed
not to cause tripping or slipping. Windows, portholes and skylights shall be so arranged and
fitted that they can be operated and cleaned safely.
11-8.3 The light switches for the working spaces shall be installed in readily accessible
positions near doors.

11-9 PROTECTION AGAINST NOISE AND VIBRATION

11-9.1 Working spaces shall be so situated, equipped and designed that crew members are
not exposed to harmful vibrations.
11-9.2 Permanent working spaces shall be so constructed and soundproofed that the health
and safety of crew members are not adversely affected by excessive noise.
11-9.3 Spaces and areas in which people are continuously exposed to noise levels that
exceed 85 dB(A) should be marked with signs “Use ear protectors” in accordance with sketch 7
of appendix 3 with diameter of at least 10 cm and people who work in them should use
individual acoustic protection devices.
11-9.4 The maximum permissible sound pressure level in the engine rooms shall be
110 dB(A). The measuring points shall be selected as a function of the maintenance work
needed during normal operation of the plant located therein.

11-10 HATCH COVERS

11-10.1 Hatch covers shall be easily accessible and safe to handle. Hatch-cover components
weighing more than 40 kg shall be designed to slide or pivot or be fitted with mechanical
opening devices. Hatch covers operated by lifting gear shall be fitted with easily accessible
attachment devices. Non-interchangeable hatch covers and hatch beams shall be clearly marked
to show the hatches to which they belong and their correct positions on those hatches.
11-10.2 Hatch covers shall have provision for being firmly secured in their working position.
Sliding covers shall be capable of being locked in their final positions; they shall be fitted with
catches to prevent accidental horizontal movement of more than 0.40 m in any other position.
Appropriate devices shall be fitted to hold stacked hatch covers in position.
ECE/TRANS/SC.3/172/Rev.1
page 92

11-10.3 The power supply for mechanically operated hatch covers must be cut off
automatically when the control switch is released.
11-10.4 Hatch covers must be capable of bearing the loads to which they are likely to be
subjected: if less than 12 people, each assumed to weigh 75 kg, can be supported on a load-
supporting hatch cover, a notice stating the number of persons that such a hatch cover can
support shall be prominently displayed. Hatch covers designed to receive deck cargo shall have
the permissible load in t/m2 marked on them. Where braces are needed to support the maximum
permissible load this shall be indicated in an appropriate place, in which case the relevant
drawings shall be kept on board.

11- 11 WINCHES
11-11.1 Winches shall be designed in such a way as to enable work to be carried out safely.
They shall be fitted with devices that prevent unintentional load release. Winches that do not
lock automatically shall be fitted with a brake that is adequate to deal with their tractive force.
11-11.2 Hand-operated winches shall be fitted with devices to prevent kick-back of the crank.
Winches that are both power driven and hand-operated shall be designed in such a way that the
motive-power control cannot actuate the hand-operated control.
 ECE/TRANS/SC.3/172/Rev.1
page 93

CHAPTER 12
CREW ACCOMMODATION
12-1 GENERAL
12-1.1 Vessels shall have accommodation for the persons lodging habitually on board, and
at least for the minimum crew.
12-1.2 Accommodation shall be so designed, arranged and fitted out as to meet the health,
safety and comfort needs of those on board. It shall be of safe and easy access and insulated
against heat and cold. Where there is no deck-level access to the accommodation and the
difference in level is 0.30 m or more the accommodation shall be accessible by means of
companionways. In the fore section of the vessel no floor shall be more than 1.20 m below the
plane of maximum draught.
12-1.3 The competent authority may authorize derogations to the prescriptions of this
chapter if the health and safety of those on board are ensured by other means. The competent
authority shall indicate on the ship’s certificate any restrictions to the vessel’s operating
mode/entry into service resulting from the derogations.

12-2 SPECIAL DESIGN REQUIREMENTS

12-2.1 Location and condition
12-2.1.1 No accommodation shall be located ahead of the plane of the collision bulkhead.
12-2.1.2 The accommodation shall be separated from engine- and boiler rooms by gastight
bulkheads and from the holds by watertight bulkheads that extend up to the deck.
12-2.1.3 The accommodation shall be directly accessible from the deck.
12-2.1.4 The accommodation complex shall have at least one day-room partitioned off from
the sleeping quarters.
12-2.1.5 The accommodation shall be so designed and arranged as to prevent as far as
possible the penetration of foul air from other areas of the vessel such as engine rooms or holds;
where forced-air ventilation is used the intake vents shall be so placed as to satisfy the above
requirements. The exhaust air from galleys or spaces equipped with sanitary installations shall
be expelled directly from the vessel.
12-2 1.6 It shall be possible to heat accommodation in accordance with its intended use.
Heating installations shall be appropriate for the weather conditions which may arise.
12-2.1.7 It shall be possible to ventilate the accommodation adequately.
12-2.1.8 Accommodation shall be protected against noise and vibration. Sound pressure levels
shall not exceed:
(i) 70 dB(A) in the living quarters;
(ii) 60 dB(A) in the sleeping quarters. This provision does not apply to vessels
operating exclusively no more then 14 hours per day. The operating mode
restriction shall be mentioned on the certificate.
ECE/TRANS/SC.3/172/Rev.1
page 94

12-2.1.9 The accommodation shall be provided with emergency exits permitting rapid
evacuation. Exits of living and sleeping quarters shall comply with the requirements of
Article 12-1.2.
12-2.1.10 Pipes carrying dangerous gases or liquids, or which are subjected to such high
internal pressure in which the slightest leak could pose a danger to human beings, shall not be
located in the accommodation or in corridors leading to the accommodation. An exception to
this rule is made for hydraulic system pipes, provided they are fitted in metal casings, and for the
pipes of liquefied gas installations for domestic purposes.
12-2.2 Dimensions of the accommodation
12-2.2.1 The clear headroom in the accommodation shall be not less than 2.00 m.
12-2.2.2 The free floor area of the living quarters shall be not less than 2 m2 per person, and in
any event not less than 8m² in total (not counting furniture, except tables and chairs).
12-2.2.3 The volume of air per person shall be at least 3.5 m3 in living quarters. In the
sleeping quarters, it shall be at least 5 m³ for the first occupant and at least 3 m3 for each
additional occupant (not counting the volume of furniture). Sleeping cabins shall, as far as
possible, be intended for no more than two persons.
12-2.2.4 The cubic capacity of each unit in the living and sleeping quarters shall be not less
than 7 m3.

12-3 APPROACHES, DOORS AND STAIRWAYS

12-3.1 Doors shall have a total height, coamings included, of at least 1.90 m and a clear
width of at least 0.60 m. The prescribed height may be achieved by means of sliding or hinged
covers or flaps. It shall be possible to open doors from either side. Coamings shall be not more
than 0.40 m high, but shall nonetheless comply with the provisions of other safety regulations.
12-3.2 Companionways shall be permanently fixed and safely negotiable. They shall be
deemed to be so when they are constructed according to the requirements of section 11-7.

12-4 DAYLIGHT AND LIGHTING

12-4.1 The accommodation shall be adequately lighted. The living quarters, galleys and, if
possible, the other compartments shall be accessible to daylight.
12-4.2 Standards of natural and artificial illumination shall be fixed by the Administration.

12-5 FITTINGS
12-5.1 Each crew member living on board shall be provided with an individual berth and an
individual clothes locker fitted with a lock. The internal measurements of the berth shall be not
less than 2.00 x 0.90 m. The height of the locker shall be not less than 1.7 m and the available
horizontal area not be less then 0.25 m2.
12-5.2 Berths shall be not less than 0.30 m above the floor. Where one berth is placed over
another, the clear headroom above each berth shall be not less than 0.60 m. Berths shall not be
arranged in tiers of more then two.
 ECE/TRANS/SC.3/172/Rev.1
page 95

12-5.3 Suitable places for storing and drying work clothes shall be provided, but not in the
sleeping quarters.

12-6 GALLEYS AND DAY-ROOMS (MESSROOMS)

12-6.1 Galleys shall comprise:
(i) A cooker;
(ii) A sink with waste connection;
(iii) A supply of potable water;
(iv) Refrigerator;
(v) Sufficient storage and working space.
12-6.2 Galleys may be combined with day-rooms.
12-6.3 Manned vessels shall have a refrigerator and where necessary cold storerooms. The
doors of cold storerooms that are large enough to admit a person must be fitted with locks that
can be opened from both sides.
12-6-4 The eating area of combined galleys/day-rooms shall be large enough to
accommodate the number of crew normally using it at the same time. Seats shall be not less than
0.60 m wide.

12-7 SANITARY INSTALLATIONS

12-7.1 The following sanitary installations at least shall be provided in vessels with
accommodation:
(i) One toilet per accommodation unit or per six crew members, which it shall be
possible to ventilate with fresh air;
(ii) One wash basin with waste pipe and hot and cold taps connected to a source of
potable water per accommodation unit or per four crew members;
(iii) One shower or bath connected up to hot and cold potable water per
accommodation unit or per six crew members.
12-7.2 The sanitary installations shall be in close proximity to the accommodation. Toilets
shall not have direct access to galleys, mess rooms or combined day-rooms/galleys.
12-7.3 Toilet compartments shall have a floor space of at least 1 m², not less than 0.75 m
wide and not less than 1.10 m long. Toilet compartments in cabins for no more than two persons
may be smaller. Where a toilet contains a wash basin and/or shower, the surface area shall be
increased at least by the surface area occupied by the wash basin and/or shower (or bath).

12-8 POTABLE-WATER INSTALLATIONS

12-8.1 Vessels with accommodation shall have one or more potable water tanks. Potable
water tank filling apertures and potable water pipes shall be marked as being intended
exclusively for potable water. Potable water filler necks shall be installed above the deck.
ECE/TRANS/SC.3/172/Rev.1
page 96

12-8.2 Potable water tanks shall:

(i) Be protected against excessive heating;
(ii) Have a capacity as prescribed by the Basin administration;
(iii) Be made of a material which resists corrosion and poses no physiological
danger;
(iv) Have a suitable, lockable opening to enable the inside to be cleaned;
(v) Have a water level indicator;
(vi) Have ventilation caps to the open air or which are fitted with appropriate
filters.
12-8.3 Potable water tanks shall not share walls with other tanks. Potable water pipes shall
not pass through tanks containing other liquids. Connections are not permitted between the
potable water supply system and other pipes. Pipes carrying gas or liquids other than potable
water shall not pass through potable water tanks.
12-8.4 Potable water pressure vessels shall operate only on uncontaminated compressed air.
Where it is produced by means of compressors, appropriate air filters and oil separators shall be
installed directly in front of the pressure vessel unless the water and the air are separated by a
diaphragm.

CHAPTER 13
FUEL-FIRED HEATING, COOKING AND REFRIGERATING EQUIPMENT
(Left void)
 ECE/TRANS/SC.3/172/Rev.1
page 97

CHAPTER 14
LIQUEFIED GAS INSTALLATIONS FOR DOMESTIC PURPOSES
14-1 GENERAL
14-1.1 Every gas installation shall consist essentially of one or more gas receptacles, one or
more pressure reducers, a distribution system and a number of gas-consuming appliances.
14-1.2 Such installations may be operated only with the gas mixture of which the customary
name is propane.

14-2 INSTALLATION
14-2.1 Gas installations shall, in all their parts, be suitable for the use of propane and shall
be built and installed in accordance with the state of the art.
14-2.2 A gas installation may be used only for domestic purposes in spaces that comply
with the requirements of the Administration.
14-2.3 There may be several separate gas installations on board. Accommodation areas
separated by a cargo hold or a fixed tank shall not be supplied by the same installation.
14-2.4 Installations which are not permanently fixed may be used only if they meet the
special requirements laid down by the Administration.

14-3 RECEPTACLES
14-3.1 Only receptacles with a capacity of between 5 and 35 kg shall be allowed. In the
case of passenger vessels, the Basin administration may approve the use of receptacles with a
larger content.
14-3.2 The receptacles shall satisfy the requirements in force. They shall bear the official
stamp certifying that they have passed the statutory tests.

14-4 LOCATION AND ARRANGEMENT OF THE SUPPLY UNIT

14-4.1 The supply unit shall be installed on deck in a special cupboard located outside the
accommodation area in such a position that it does not interfere with movement on board. It
shall not, however, be installed against the forward or after bulwark plating. The cupboard may
be a wall cupboard set into the superstructure provided that it is gastight to that superstructure
and can only be opened to the outside. It shall be so located that the pipes leading to the gas
consumption points are as short as possible.
Each installation may have up to four receptacles in operation simultaneously, with
or without the use of an automatic changeover valve. The number of receptacles on board,
including spare receptacles, shall not exceed six per installation.
On passenger vessels having galleys or canteens for the passengers, up to six
receptacles per installation may be in operation simultaneously, with or without the use of an
automatic changeover valve. The number of receptacles on board such vessels, including spare
receptacles, shall not exceed nine per installation.
ECE/TRANS/SC.3/172/Rev.1
page 98

The pressure reducer or, in the case of two-stage reduction, the first pressure reducer
shall be fitted to the inside wall of the cupboard for the receptacles.
14-4.2 The supply unit shall be so installed that any leaking gas can escape from the
cupboard without any risk that it may penetrate the vessel or come into contact with any possible
source of ignition.
14-4.3 The cupboard shall be constructed of fire-resistant materials and shall be adequately
ventilated by openings at the top and bottom. The cupboard shall be fitted with a locking device
preventing unauthorized persons from gaining access to the receptacles. The receptacles shall be
placed upright in the cupboard in such a way that they cannot overturn.
14-4.4 The cupboard shall be so constructed and situated that the temperature of the
receptacles cannot exceed 50 °C.
14-4.5 The words “liquefied gas” and “no naked lights or fires and no smoking” symbol at
least 100 mm in diameter in accordance with sketch 2 of appendix 3 shall be affixed to the outer
wall of the cupboard.

14-5 SPARE AND EMPTY RECEPTACLES

Spare and empty receptacles which are not stored in the supply unit shall be stored
outside the accommodation area, and the wheelhouse in a cupboard, constructed in accordance
with the requirements of section 14-4, paragraphs 14-4.2 to 14-4.5.

14-6 PRESSURE REDUCERS

14-6.1 The gas-consuming appliances may be connected to the receptacles only through a
distribution system fitted with one or more pressure reducers to bring the gas pressure down to
the working pressure. The pressure may be reduced in one or two stages. All pressure reducers
shall be set permanently at a pressure determined in accordance with section 14-7 below.
14-6.2 The final pressure reducer shall be either fitted with or followed by a device to
protect the piping automatically against excess pressure in the event of a malfunction of the
pressure reducer. Any gas which this protection device allows to escape shall be evacuated into
the open air without any risk that it may penetrate the vessel or come into contact with any
possible source of ignition; if necessary a special vent shall be fitted for this purpose.
14-6.3 The safety devices and the vents shall be protected against ingress of water.

14-7 PRESSURE
14-7.1 The pressure at the outlet of the final pressure reducer shall not be more than 5 kPa
above atmospheric pressure, with a tolerance of 10 %.
14-7.2 In the case of two-stage reduction, the intermediate pressure shall not be more than
250 kPa above atmospheric pressure.

14-8 PIPING AND FLEXIBLE TUBES

14-8.1 The piping shall consist of fixed steel or copper tubing.
 ECE/TRANS/SC.3/172/Rev.1
page 99

The pipes connected to the receptacles, however, shall consist of high pressure
flexible tubing or spiral tubes suitable for the gas used. The gas consuming appliances may, if
they are not installed as fixtures, be connected up by means of suitable flexible tubes not more
than 1 m long.
14-8.2 The piping shall be able to withstand all influences to which it may be subjected
under normal operating conditions on board, in particular corrosion and stresses, and its
characteristics and layout shall be such that it ensures a satisfactory flow of gas at the appropriate
pressure to the gas consuming appliances.
14-8.3 The piping shall include as few joints as possible. The piping and the joints shall be
gastight and shall remain gastight despite any vibration or expansion to which they may be
subjected.
14-8.4 The piping shall be readily accessible, properly fixed and protected at every point
where it might be subjected to impact or friction, particularly where it passes through metal
bulkheads or other metal partitions.
The entire outer surface of steel piping shall be treated against corrosion.
14-8.5 Flexible pipes and their joints shall be able to withstand any stresses which may
occur under normal operating conditions on board. They shall be fitted without load and in such
a way that they cannot be overheated and can be inspected throughout their length.

14-9 DISTRIBUTION SYSTEM

14-9.1 No part of a gas installation shall be situated in the machinery space.
14-9.2 It shall be possible to shut off the entire distribution system by means of a valve
which is readily and quickly accessible.
14-9.3 Each gas-consuming appliance shall be supplied by a separate branch of the
distribution system, and each such branch shall be controlled by a separate closing device.
14-9.4 The valves shall so far as possible be protected from the weather and against impact.
14-9.5 The ends of pipes intended for connection to gas-consuming appliances shall be
closable by a flange or cap even if they are equipped with a shut-off valve.
14-9.6 An inspection joint shall be fitted after each pressure reducer. It shall be ensured,
using a closing device, that in pressure tests the pressure reducer is not exposed to the test
pressure.

14-10 GAS-CONSUMING APPLIANCES AND THEIR INSTALLATION

14-10.1 The only consuming appliances that may be installed shall be those which have been
approved by the Administration and which are equipped with devices that effectively prevent the
escape of gas in case of extinction either of the burner or of the pilot flame.
14-10.2 Each appliance shall be so placed and connected as to avoid any risk that the
connecting piping may be accidentally wrenched loose.
ECE/TRANS/SC.3/172/Rev.1
page 100

14-10.3 The installation of gas-consuming appliances in the wheelhouse shall be permitted

only if the wheelhouse is so constructed that no leaking gas can escape into the lower parts of the
vessel.
14-10.4 Gas-consuming appliances may be installed in sleeping rooms only if the combustion
process does not depend on the ambient air.
14-10.5 Gas-consuming appliances in which the combustion process depends on the ambient
air shall be installed only in rooms of sufficient size.

14-11 VENTILATION AND EVACUATION OF THE COMBUSTION GASES

14-11.1 Heating and water-heating appliances and refrigerators shall be connected to a duct
for evacuating combustion gases into the open air.
14-11.2 In spaces containing gas-consuming appliances in which the combustion process
depends on the ambient air, the supply of fresh air and the evacuation of the combustion gases
shall be ensured by means of apertures of adequate dimensions determined according to the
capacity of the appliances, with a clear section of at least 150 cm2 per aperture.
14-11.3 The ventilation apertures shall not have any closing device and shall not lead into
sleeping rooms.
14-11.4 The evacuation devices shall be such as to ensure reliable and effective evacuation of
the combustion gases. They shall be non-combustible and their effectiveness shall not be
impaired by the room ventilators.

14-12 INSTRUCTIONS FOR USE AND SAFETY

A notice containing instructions on the use of the installation shall be affixed on
board in a suitable place. The notice shall bear, in particular, the following instructions:
“The valves of receptacles which are not connected to the distribution system shall
be closed even if the receptacles are presumed to be empty.”
“Flexible pipes shall be renewed as soon as their condition so requires.”
“All receptacles shall be kept connected up unless the corresponding connecting
pipes are closed by valves or sealed.”

14-13 INSPECTION
Before a gas installation is put into service, after any modification or repair and at
each renewal of the entry referred to in section 14-15 below, the whole of the installation shall be
submitted to an expert recognized by the Administration for inspection. At the time of the
inspection, the expert shall check whether the installation complies with the requirements of this
chapter.
The expert shall submit a report to the competent authority of the Administration.

14-14 TESTS AND TRIALS

The completed installation shall be subjected to the following tests and trials:
 ECE/TRANS/SC.3/172/Rev.1
page 101

14-14.1 Medium-pressure piping between the first pressure reducer and the valves upstream
of the final pressure reducer:
(i) Strength test, carried out with air, an inert gas or a liquid at a pressure
prescribed by the Administration. This pressure shall not be less than 2 MPa
above atmospheric pressure;
(ii) Gastightness test, carried out with air or an inert gas at a pressure of 350 kPa
above atmospheric pressure.
14-14.2 Piping at the working pressure between the single or final pressure reducer and the
valves upstream of the gas-consuming appliances:
Gastightness test, carried out with air or an inert gas at a pressure of 100 kPa above
atmospheric pressure.
14-14.3 Piping situated between the single or final pressure reducer and the controls of the
gas-consuming appliance:
Gastightness test at a pressure of 20 kPa above atmospheric pressure.
14-14.4 In the tests referred to in paragraph 14-14.1 (ii), 14-14.2 and 14-14.3, the piping shall
be considered gastight if, after sufficient time has elapsed for thermal balancing, no drop in the
test pressure is noted during the following 10 minutes.
14-14.5 Receptacle connectors, piping and other fittings subjected to the pressure in the
receptacles, and joint between the pressure reducer and the piping:
(i) Strength test, carried out with air, an inert gas or liquid at the pressure
prescribed by the Administration but in any case not less than 2.5 MPa above
atmospheric pressure;
(ii) Gastightness test, carried out with a foam-producing product at the working
pressure.
14-14.6 All gas-consuming appliances shall, on being put into service, be tested at the
working pressure to ensure that combustion is satisfactory with the controls in the different
positions.
The safety devices shall be checked to ensure that they work properly.
14-14.7 After the test referred to in paragraph 14-14.6 above, trials shall be carried out with
every gas-consuming appliance connected to a flue to check whether, after five minutes'
operation at full capacity, with windows and doors closed and the ventilation devices in
operation, any combustion gases are escaping through the air intake.
If combustion gases are escaping otherwise than sporadically, the cause shall
immediately be sought and eliminated. The appliance shall not be approved until all defects
have been corrected.

14-15 ENTRY IN THE APPROPRIATE VESSEL'S PAPER

14-15.1 For every gas installation, the appropriate vessel's paper shall contain an entry stating
that the installation complies with the requirements of this chapter.
ECE/TRANS/SC.3/172/Rev.1
page 102

14-15.2 This entry shall be made by the competent authority of the Administration following
the inspection referred to in section 14-13, above.
14-15.3 The entry shall be valid for a period not exceeding three years and may be renewed
only after another inspection has been carried out in accordance with section 14-13.
At the request of the owner of the vessel, accompanied by a statement of his reasons
for making the request, the Administration may extend the validity of the entry by not more than
three months without carrying out the inspection referred to in section 14-13 above. Such
extension shall be granted in a written document which shall be kept on board the vessel. Such
extension shall not affect the date of the next scheduled inspection.
 ECE/TRANS/SC.3/172/Rev.1
page 103

CHAPTER 15
SPECIAL PROVISIONS FOR PASSENGER VESSELS

15-1 GENERAL PROVISIONS

15-1.1 The following provisions shall not apply:
(i) 4-4.2, 4-4.3.11 and 4-4.4;
(ii) 8-1.6.2 sentence 2 and 8-1.6.7;
(iii) 9-2.11.3 sentence 2 for rated voltages of over 50V.
15-1.2 The following items of equipment are prohibited on passenger vessels:
(i) Lamps powered by liquefied gas or liquid fuel;
(ii) Vaporizing oil-burner stoves;
(iii) Solid fuel heaters;
(iv) Devices fitted with wick burners;
(v) Liquefied gas devices according to chapter 14.
15-1.3 Vessels without their own power cannot be licensed for passenger transport.
15-1.4 On passenger vessels, areas shall be provided for use by persons with reduced
mobility, according to the provisions of this chapter and with due regard to the Guidelines for
passenger vessels also suited for carrying persons with reduced mobility (annex to Resolution
No. 25, revised). If the application of the provisions of this chapter which take into account the
specific safety needs of people with reduced mobility is difficult in practice or incurs
unreasonable costs, the Administration can allow derogations from these provisions. These
derogations shall be mentioned in the ship’s certificate.
15-2 VESSELS’S HULL
15-2.1 In the course of periodical inspections referred to in 2-4, the thickness of the outside
plating of steel passenger vessels shall be determined as follows:
(i) The minimum thickness tmin of the bottom, bilge and side plating of the outer
hull of passenger vessels is determined in accordance with the larger value of
the following formulae:
t1 min = 0.006 . a . T [mm]; t2 min = f . 0.55 . LWL [mm].
In these formulae:
f = 1 + 0.0013 . (a – 500);
a = longitudinal or transverse frame spacing [mm], and where the
frame spacing is less than 400 mm, a = 400 mm should be entered.
(ii) It is permissible to fall short of the minimum value determined in accordance
with (i) above for the plate thickness in cases where the permitted value has
been determined and certified on the basis of a mathematical proof for the
sufficient strength (longitudinal, transverse and local) of the vessel's hull.
ECE/TRANS/SC.3/172/Rev.1
page 104

(iii) At no point of the outside plating shall the thickness calculated in accordance
with (i) or (ii) above be less than 3 mm.
(iv) Plate renewals shall be carried out when bottom, bilge or side plate thicknesses
have fallen short of the minimum value determined in accordance with (i) or
(ii), in conjunction with (iii) above.
15-2.2 The number and position of bulkheads shall be selected such that, in the event of
flooding, the vessel remains buoyant according to 15-3.7 to 15-3.13. Every portion of the
internal structure which affects the efficiency of the subdivision of such vessels shall be
watertight, and shall be of a design which will maintain the integrity of the subdivision.
15-2.3 The distance between the collision bulkhead and the forward perpendicular shall be
at least 0.04 LWL and not more than 0.04 LWL + 2 m.
15-2.4 A transverse bulkhead may be fitted with a bulkhead recess, if all parts of this offset
lie within the safe area.
15-2.5 The bulkheads, which are taken into account in the damaged stability calculation
according to 15-3.7 to 15-3.13, shall be watertight and be installed up to the bulkhead deck.
Where there is no bulkhead deck, these bulkheads shall extend to a height at least 20 cm above
the margin line.
15-2.6 The number of openings in these bulkheads shall be kept as low as is consistent with
the type of construction and normal operation of the ship. Openings and penetrations shall not
have a detrimental effect on the watertight function of the bulkheads.
15-2.7 Collision bulkheads shall have no openings and no doors.
15-2.8 Bulkheads according to 15-2.5 separating the engine rooms from passenger areas or
crew and shipboard personnel accommodation shall have no doors.
15-2.9 Manually operated doors without remote control in bulkheads referred to in 15-2.5,
are permitted only in areas not accessible to passengers. They shall:
(i) Remain closed at all times and be opened only temporarily to allow access;
(ii) Be fitted with suitable devices to enable them to be closed quickly and safely;
(iii) Display the following notice on both sides of the doors: “Close door
immediately after passing through”.
15-2.10 Doors in bulkheads referred to in 15-2.5, that are open for long periods shall comply
with the following requirements:
(i) They shall be capable of being closed from both sides of the bulkhead and from
an easily accessible point above the bulkhead decks;
(ii) After being closed by remote control the door shall be such that it can be
opened again locally and closed safely. Closure shall not be impeded by
carpeting, foot rails or other obstructions;
(iii) The time taken for the remote-controlled closure process shall be at least
30 seconds but not more than 60 seconds;
 ECE/TRANS/SC.3/172/Rev.1
page 105

(iv) During the closure procedure an automatic acoustic alarm shall sound by the
door;
(v) The door drive and alarm shall also be capable of operating independently of
the main on-board power supply. There shall be a device at the location of the
remote control that displays whether the door is open or closed.
15-2.11 Doors in bulkheads referred to in 15-2.5, and their actuators shall be located in the
safe area.
15-2.12 There shall be a warning system in the wheelhouse to indicate which of the doors in
bulkheads referred to in 15-2.5 is open.
15-2.13 Open-ended piping and ventilation ducts shall be offset in such a way that, in any
conceivable flooding, no additional spaces or tanks are flooded through them.
(i) If several compartments are openly connected by piping or ventilation ducts,
such piping and ducts shall, in an appropriate place, be lead above the
waterline corresponding to the worst possible flooding;
(ii) Piping need not meet the requirement above, if shut-off devices are fitted in the
piping where it passes through the bulkheads and which can be remotely
controlled from a point above the bulkhead deck;
(iii) Where a pipe work system has no open outlet in a compartment, the pipe work
shall be regarded as intact n the event of this compartment being damaged, if it
runs within the safe area and is more than 0.50 m from the bottom of the
vessel.
15-2.14 Remote controls of bulkhead doors according to 15-2.10 and shut-off devices
according to 15-2.13 (ii) above the bulkhead deck shall be clearly indicated as such.
15-2.15 Where double bottoms are fitted, their height shall be at least 0.60 m, and where
wing voids are fitted, their width shall be at least 0.60 m.
15-2.16 Windows may be situated below the margin line, if they are watertight, cannot be
opened, possess sufficient strength and conform to 15-6.15.

15-3 STABILITY
15-3.1 It shall be proved by a calculation based on the results from the application of a
standard for intact stability that the intact stability of the vessel is appropriate. All calculations
shall be carried out free to heel, trim and sinkage. The light ship data taken into account for the
stability calculation shall be determined by means of a heeling test.
15-3.2 The intact stability shall be proven for the following standard load conditions:
(i) At the start of the voyage: 100 % passengers, 98 % fuel and fresh water, 10 %
waste water;
(ii) During the voyage: 100 % passengers, 50 % fuel and fresh water, 50 % waste
water;
(iii) At the end of the voyage: 100 % passengers, 10 % fuel and fresh water, 98 %
waste water;
ECE/TRANS/SC.3/172/Rev.1
page 106

(iv) Unladen vessel: no passengers, 10 % fuel and fresh water, no waste water.
For all standard load conditions, the ballast tanks shall be considered as either empty
or full in accordance with normal operational conditions.
In addition, the requirement of 15-3.3 (iv) shall be proved for the following load
condition:
100 % passengers, 50 % fuel and fresh water, 50 % waste water, all other liquid
(including ballast) tanks are considered filled to 50 %.
15-3.3 The proof of adequate intact stability by means of a calculation shall be produced
using the following definitions for the intact stability and for the standard load conditions
mentioned in 15-3.2 (i) to (iv):

(i) The maximum righting lever hmax shall occur at a heeling angle ϕmax ≥ (ϕmom +
3°) and shall not be less than 0.20 m. However, in case ϕf < ϕmax the righting
lever at the downflooding angle ϕf shall not be less than 0.20 m;
(ii) The downflooding angle ϕf shall not be less than (ϕmom + 3°);
(iii) The area A under the curve of the righting levers shall, depending on the
position of ϕf and ϕmax , reach at least the following values:

Case A
1 ijmax ≤ 15° or ijf 0.05 m rad up to the smaller of the angles
≤ 15° to angles ijmax or ijf
2 15° < ijmax < 30° ijmax ≤ ijf 0.035 + 0.001· (30 - ijmax) m rad up to the
angle ijmax
3 15° < ijf < 30° ijmax > ijf 0.035 + 0.001· (30 - ijf) m rad up to the
angle ijf
4 ijmax ≥ 30° and
ijf ≥ 30° 0.035 m rad up to the angle ij = 30°

where:
hmax is the maximum lever;
ϕ is the heeling angle;
ϕf is the downflooding angle, that is the heeling angle, at which
openings in the hull, in the superstructure or deck houses which
cannot be closed so as to be watertight, submerge;
ϕmom the maximum heeling angle according to (v);
ϕmax is the heeling angle at which the maximum righting lever occurs;
A area beneath the curve of the righting levers.
(iv) the initial metacentric height, GM 0 , corrected by the effect of the free surfaces
of liquid in tanks, shall not be less than 0.15 m;
(v) in each of the following two cases the heeling angle ijmom shall not exceed 12°:
 ECE/TRANS/SC.3/172/Rev.1
page 107

• in application of the heeling moment due to passengers and

wind according to 15-3.4 and 15-3.5;
• in application of the heeling moment due to passengers and
turning according to 15-3.4 and 15-3.6
(vi) for a heeling moment resulting from moments due to passengers, wind and
turning according to 15-3.4, 15-3.5 and 15-3.6, the residual freeboard shall be
not less than 200 mm;
(vii) for vessels with windows or other openings in the hull located below the
bulkhead decks and not closed watertight, the residual safety clearance shall be
at least 100 mm on the application of the three heeling moments resulting from
subsection (vi).
15-3.4 The heeling moment due to one-sided accumulation of persons shall be calculated
according to the following formulae:

M P = g ⋅ P ⋅ y = g ⋅ ¦ Pi ⋅ y i
[kNm]
where:
P = total mass of persons on board in [t], calculated by adding up
the maximum permitted number of passengers and the
maximum number of shipboard personnel and crew under
normal operating conditions, assuming an average mass per
person of 0.075 t;
y = lateral distance of centre of gravity of total mass of persons P
from centre line in [m];
g = acceleration of gravity (g = 9.81 m/s2);
Pi = mass of persons accumulated on area Ai in [t];
Pi = ni · 0.075 ·Ai [t]
where:
Ai = area occupied by persons in [m²];
ni = number of persons per square meter;
ni = 3.75 for free deck areas and deck areas with
movable furniture; for deck areas with fixed
seating furniture such as benches, ni shall be
calculated by assuming an area of 0.50 m in
width and 0.75 m in seat depth per person;
yi = lateral distance of geometrical centre of area Ai
from centre line in [m].
The calculation shall be carried out for an accumulation of persons both to starboard
and to port.
ECE/TRANS/SC.3/172/Rev.1
page 108

The distribution of persons shall correspond to the most unfavourable one from the
point of view of stability. Cabins shall be assumed unoccupied for the calculation of the persons’
heeling moment.
For the calculation of the loading cases, the centre of gravity of a person should be
taken as 1 m above the lowest point of the deck at 0.5 LWL, ignoring any deck curvature and
assuming a mass of 0.075 t per person.
A detailed calculation of deck areas which are occupied by persons may be dispensed
with if the following values are used:
P = 1.1 · Fmax · 0.075 for day trip vessels
1.5 · Fmax · 0.075 for cabin vessels
where:
Fmax = maximum permitted number of passengers on board;
Y = B/2 in [m].
15-3.5 The heeling moment due to wind pressure (Mwst) shall be calculated as follows:
Mwst = pw · Aw · (lw+T/2) [kNm]
where:
pw = the specific wind pressure of 0.15 kN/m2 for zone 3 and 0.25
kN/m2 for zones 1 and 2;
Aw = lateral plane of the vessel above the waterline according to
the considered load conditions as given in 15-3.2, in m2;
lw = distance of the centre of gravity of the lateral plane AW from
the waterline according to the considered load conditions as
given in 15-3.2, in m.
15-3.6 The heeling moment due to centrifugal force (Mcf), caused by the turning of the
vessel, shall be calculated as follows:

Mcf = ccf . CB. . v² . D/LWL . (KG - T/2) [kNm]

where:
ccf = a coefficient of 0.45;
CB = block coefficient (if not known, taken as 1.0);
v = maximum speed of the vessel in m/s;
KG = distance between the centre of gravity and the baseline in m.
For passenger vessels with propulsion systems according to 6-6, Mcf shall be derived
from full-scale or model tests or else from corresponding calculations.
15-3.7 It shall be proved, by means of a calculation that the damaged stability of the vessel
is appropriate.
15-3.8 Buoyancy of the vessel in the event of flooding shall be proven for the standard load
conditions specified in 15-3.2. Accordingly, mathematical proof of sufficient stability shall be
 ECE/TRANS/SC.3/172/Rev.1
page 109

determined for the three intermediate stages of flooding (25 %, 50 % and 75 % of flood build-
up) and for the final stage of flooding.
15-3.9 Vessels operating in zones 1, 2 and 3 shall comply with 1-compartment status and 2-
compartment status. 3
The following assumptions concerning the extent of damage shall be taken into
account in the event of flooding:

1-compartment status 2-compartment status

Dimension of the side damage
longitudinal l 0.10 ǜ LWL, however not less 0.05 ǜ LWL, however not less
[m] than 4.00 m than 2.25 m
transverse b B/5 0,59
[m]
vertical h [m] from vessel bottom to top without delimitation
Dimension of the bottom damage
longitudinal l 0,10 ǜ LWL, however not less 0,05 ǜ LWL, however not less
[m] than 4.00 m than 2.25 m
transverse b B/5
[m]
vertical h [m] 0,59; pipe work installed according to 15-2.13 (iii), shall be
deemed intact

(i) For 1-compartment status the bulkheads can be assumed to be intact if the
distance between two adjacent bulkheads is greater than the damage length.
Longitudinal bulkheads at a distance of less than B/3 from the outer plating
measured perpendicular to centre line from the shell plating at the maximum
draught shall not be taken into account for calculation purposes;
(ii) For 2-compartment status, each bulkhead within the extent of damage, will be
assumed to be damaged. The vessel shall remain buoyant after flooding;
(iii) The lowest point of every non-watertight opening (e.g. doors, windows, access
hatchways) shall lie at least 0.10 m above the damaged waterline. The
bulkhead deck shall not be immersed in the final stage of flooding;
(iv) Permeability is assumed to be 95 %. If it is proven by a calculation that the
average permeability of any compartment is less than 95 %, the calculated
value can be used instead;
The values to be adopted shall not be less than:
• Lounges 95 %
• Engine and boiler rooms 85 %

3
The Basin administration may waive the requirements prescribed in this paragraph with regard to the 2-
compartment status.
ECE/TRANS/SC.3/172/Rev.1
page 110

• Luggage and store rooms 75 %

Double bottoms, fuel bunkers, ballast tanks and other tanks, depending on
whether, according to their intended purpose, they are to be assumed to be full
or empty for the vessel floating at the plane of maximum draught 0 or 95 %;
(v) If damage of a smaller dimension than specified above produces more
detrimental effects with respect to heeling or loss of metacentric height, such
damage shall be taken into account for calculation purposes.
15-3.10 For all intermediate stages of flooding referred to in 15-3.8, the following criteria
shall be met:

(i) The heeling angle ϕ at the equilibrium position of the intermediate stage in
question shall not exceed 15°;
(ii) Beyond the heel in the equilibrium position of the intermediate stage in
question, the positive part of the righting lever curve shall display a righting
lever value of GZ ≥ 0.02 m before the first unprotected opening becomes
immersed or a heeling angle ij of 25° is reached;
(iii) Non-watertight openings shall not be immersed before the heel in the
equilibrium position of the intermediate stage in question has been reached;
(iv) The calculation of free surface effect in all intermediate stages of flooding shall
be based on the gross surface area of the damaged compartments.
15-3.11 During the final stage of flooding, the following criteria shall be met taking into
account the heeling moment in accordance with 15-3.4:

(i) The heeling angle ϕE shall not exceed 10°;

(ii) Beyond the equilibrium position the positive part of the righting lever curve
shall display a righting lever value of GZR ≥ 0.02 m with an area A ≥ 0.0025 m
rad. These minimum values for stability shall be met until the immersion of
the first unprotected opening or in any case before reaching a heeling angle ϕm
of 25°;
(iii) Non-watertight openings shall not be immersed before the equilibrium position
has been reached; if such openings are immersed before this point, the rooms
affording access are deemed to be flooded for damaged stability calculation
purposes.
 ECE/TRANS/SC.3/172/Rev.1
page 111

lever GZ [m] ϕE ≤ 10° A≥ 0.0025 mrad

GZ R > 0.02 m

GZ k (lever due to the

heeling moment in
accordance with 15-3.4)

heeling angle ϕ [°]

first unprotected opening in
the water, but ϕm ≤ 25°

equilibrium in
flooded condition
equilibrium in flooded condition due to the
heeling moment in accordance with 15-3.4
where:
E is the heeling angle in the final stage of flooding taking into
account the moment in accordance with 15-3.4;
m is the angle of vanishing stability or the angle at which the first
unprotected opening immerses or 25°; whichever is less is to be
used;
GZR is the remaining righting lever in the final stage of flooding taking
into account the moment in accordance with 15-3.4;
GZK is the heeling lever resulting from the moment in accordance with
15-3.4;
15-3.12 The shut-off devices which shall be able to be closed watertight shall be marked
accordingly.
15-3.13 If cross-flood openings to reduce asymmetrical flooding are provided, they shall
meet the following conditions:
(i) For the calculation of cross-flooding, IMO Resolution A.266 (VIII) shall be
applied;
(ii) They shall be self-acting;
(iii) They shall not be equipped with shut-off devices;
(iv) The total time allowed for compensation shall not exceed 15 minutes.

15-4 SAFETY CLEARENCE AND FREEBOARD

15-4.1 The safety clearance shall be at least equal to the sum of:
(i) The additional lateral immersion, which, measured on the outside plating, is
produced by the permissible heeling angle according to 15-3.3 (v); and
ECE/TRANS/SC.3/172/Rev.1
page 112

(ii) The residual safety clearance according to 15-3.3 (vii).

For vessels without a bulkhead deck, the safety clearance shall be not less than:
1,900 mm in zone 1, 1000 mm in zone 2 and 500 mm in zone 3.
15-4.2 The freeboard shall be at least equal to the sum of:
(i) The additional lateral immersion, which, measured on the outside plating, is
produced by the heeling angle according to 15-3.3 (v), and
(ii) The residual freeboard according to 15-3.3 (vi).
However, the remaining freeboard shall be not less than: 600 mm in zone 1,400 mm
in zone 2 and 300 mm in zone 3.
15-4.3 The maximum draught level is to be set so as to ensure compliance with the safety
clearance according to 15-4.1, and the freeboard according to 15-4.2, 15-2 and 15-3.
15-4.4 For safety reasons, the Administration may stipulate a greater safety clearance or a
greater freeboard.

15-5 MAXIMUM PERMITTED NUMBER OF PASSENGERS

15-5.1 The Administration sets the maximum permitted number of passengers and enters
this number on the certificate.
15-5.2 The maximum permitted number of passengers shall not exceed any of the following
values:
(i) Number of passengers for whom the existence of an evacuation area according
to 15-6.8 has been proven;
(ii) Number of passengers that has been taken into account for the stability
calculation according to 15-3;
(iii) Number of available berths for passengers on cabin vessels used for voyages
including overnight stays.
15-5.3 For cabin vessels which are also used as day trip vessels, the number of passengers
shall be calculated for use, both as a day trip vessel and as a cabin vessel, and entered on the
certificate.
15-5.4 The maximum permitted number of passengers shall be displayed on clearly legible
and prominently positioned notices on board the vessel.

15-6 PASSENGER ROOMS AND AREAS

15-6.1 Passenger rooms shall:
(i) On all decks, be located aft of the level of the collision bulkhead and, as long
as they are below the bulkhead deck, forward of the level of the aft-peak
bulkhead;
(ii) Be separated from the engine and boiler rooms in a gas-tight manner; and
 ECE/TRANS/SC.3/172/Rev.1
page 113

(iii) Be so arranged, that sight lines in accordance with 7-2 do not pass through
them.
15-6.2 Cupboards and rooms referred to in 3A-3 and intended for the storage of flammable
liquids shall be outside the passenger area.
15-6.3 The number and width of the exits of passenger rooms shall comply with the
following requirements:
(i) Rooms or groups of rooms designed or arranged for 30 or more passengers or
including berths for 12 or more passengers shall have at least two exits. On
day trip vessels, one of these two exits can be replaced by two emergency
exits; rooms, with the exception of cabins, and groups of rooms that have only
one exit, shall have at least one emergency exit;
(ii) If rooms are located below the bulkhead deck, one of the exits can be a
watertight bulkhead door, according to 15-2.10, leading into an adjacent
compartment from which the upper deck can be reached. The other exit shall
lead directly or, if permitted in accordance with (i), as an emergency exit into
the open air, or to the bulkhead deck. This requirement does not apply to
individual cabins;
(iii) Exits according to (i) and (ii) shall be suitably arranged and shall have a clear
width of at least 0.80 m and also a clear height of at least 2.00 m. For doors of
passenger cabins and other small rooms, the clear width can be reduced to
0.70 m;
(iv) In the case of rooms or groups of rooms intended for more than 80 passengers
the sum of the widths of all exits intended for passengers and which shall be
used by them in an emergency, shall be at least 0.01 m per passenger;
(v) If the total width of the exits is determined by the number of passengers, the
width of each exit shall be at least 0.005 m per passenger;
(vi) Emergency exits shall have a shortest side at least 0.60 m long or a minimum
diameter of 0.70 m. They shall open in the direction of escape and be marked
on both sides;
(vii) Exits of rooms intended for use by persons with reduced mobility shall have a
clear width of at least 0.90 m. Exits normally used for embarking and
disembarking people with reduced mobility shall have a clear width of at least
1.50 m.
15-6.4 Doors of passenger rooms shall comply with the following requirements:
(i) With the exception of doors leading to connecting corridors, they shall be
capable of opening outwards or be constructed as sliding doors;
(ii) Cabin doors shall be made in such a way that they can also be unlocked from
the outside at any time;
(iii) Powered doors shall open easily in the event of failure of the power supply to
this mechanism;
ECE/TRANS/SC.3/172/Rev.1
page 114

(iv) For doors intended for use by persons with reduced mobility, there shall be
from the direction from which the door opens, a minimum clearance of 0.60 m
between the inner edge of the doorframe on the lock side and an adjacent
perpendicular wall.
15-6.5 Connecting corridors shall comply with the following requirements:
(i) They shall have a clear width of at least 0.80 m. If they lead to rooms used by
more than 80 passengers, they shall comply with the provisions mentioned in
15-6.3 (iv) and (v) regarding the width of the exits leading to connecting
corridors;
(ii) Their clear height shall be not less than 2.00 m;
(iii) Connecting corridors intended for use by persons with reduced mobility shall
have a clear width of 1.30 m. Connecting corridors more than 1.50 m wide
shall have hand rails on either side;
(iv) Where a part of the vessel or a room intended for passengers is served by a
single connecting corridor, the clear width thereof shall be at least 1.00 m;
(v) Connecting corridors shall be free of steps;
(vi) They shall lead only to open decks, rooms or staircases;
(vii) Dead ends in connecting corridors shall be not longer than 2.00 m.
15-6.6 In addition to the provisions of 15-6.5, escape routes shall also comply with the
following requirements:
(i) Stairways, exits and emergency exits shall be so disposed that, in the event of a
fire in any given area, the other areas may be evacuated safely;
(ii) The escape routes shall lead by the shortest route to evacuation areas according
to 15-6.8;
(iii) Escape routes shall not lead through engine rooms or galleys;
(iv) There shall be no rungs, ladders or the like installed at any point along the
escape routes;
(v) Doors to escape routes shall be constructed in such a way as not to reduce the
minimum width of the escape route referred to in 15-6.5 (i) or (iv);
(vi) Escape routes and emergency exits shall be clearly signed. The signs shall be
lit by the emergency lighting system.
15-6.7 Escape routes and emergency exits shall have a suitable safety guidance system.
15-6.8 For all persons on board, there shall be muster areas available which satisfy the
following requirements:
(i) The total area of the muster areas (AS) shall correspond to at least the following
value:
Day trip vessels: AS = 0.35 . Fmax [m²]
 ECE/TRANS/SC.3/172/Rev.1
page 115

Cabin vessels: AS = 0.45 . Fmax [m²]

In these formulae, the following definition applies:
Fmax = maximum permitted number of passengers on
board;
(ii) Each individual muster or evacuation area shall be larger than 10 m2;
(iii) The muster areas shall be clear of furniture, whether movable or fixed;
(iv) If movable furniture is located in a room in which muster areas are defined, it
shall be secured appropriately to avoid slipping;
(v) If fixed seats or benches are located in a room in which muster areas are
defined the corresponding number of persons need not be taken into account
when calculating the total area of muster areas according to (i). However, the
number of persons for whom fixed seats or benches in a certain room are taken
into account must not exceed the number of persons for whom muster areas are
available in this room;
(vi) Life-saving appliances shall be easily accessible from the evacuation areas;
(vii) It shall be possible to evacuate people safely from these evacuation areas, using
either side of the vessel;
(viii) The muster areas shall lie above the margin line;
(ix) The muster and evacuation areas are to be shown as such in the safety plan and
signposted on board the vessel;
(x) The provisions of (iv) and (v) also apply to free decks on which muster areas
are defined;
(xi) If collective life-saving appliances complying with 10-5.1.1.1, are available on
board, the number of persons for whom such appliances are available may be
disregarded when calculating the total surface area of the muster areas referred
to in (i);
(xii) However, in all cases where reductions to (v), (x) and (xi) are applied the total
area according to (i) shall be sufficient for at least 50 % of the maximum
permitted number of passengers.
15-6.9 Stairs and their landings in the passenger areas shall comply with the following
requirements:
(i) They shall be constructed in accordance with a recognized international
standard;
(ii) They shall have a clear width of at least 0.80 m or, if they lead to connecting
corridors or areas used by more than 80 passengers, at least 0.01 m per
passenger;
(iii) They shall have a clear width of at least 1.00 m if they provide the only means
of access to a room intended for passengers;
(iv) Where there is not at least one staircase on each side of the vessel in the same
room, they shall lie in the safe area;
ECE/TRANS/SC.3/172/Rev.1
page 116

(v) In addition, stairs intended for use by persons with reduced mobility shall
comply with the following requirements:
• The gradient of the stairs shall not exceed 32°;
• The stairs shall have a clear width of at least 0.90 m;
• Spiral staircases are not allowed;
• The stairs shall not run in a direction transverse to the vessel;
• The handrails of the stairs shall extend approximately 0.30 m beyond the
top and bottom of the stairs without restricting traffic routes;
• Handrails, front sides of at least the first and the last step as well as the floor
coverings at the ends of the stairs shall be colour highlighted.
15-6.10 Lifts intended for persons with reduced mobility, and lifting equipment, like stairlifts
or lifting platforms, shall be constructed according to a relevant standard or a regulation of the
Administration.
15-6.11 Parts of the deck intended for passengers, and which are not enclosed, shall comply
with the following requirements:
(i) They shall be surrounded by a fixed bulwark or guard rail at least 1.00 m high
or a railing according to a recognized international standard. Bulwarks and
railings of decks intended for use by persons with reduced mobility shall be at
least 1.10 m high;
(ii) Openings and equipment for embarking or disembarking and also openings for
loading or unloading shall be such that they can be secured and have a clear
width of at least 1.00 m. Openings, used normally for the embarking or
disembarking of persons with reduced mobility, shall have a clear width of at
least 1.50 m;
(iii) If the openings and equipment for embarking or disembarking cannot be
observed from the wheelhouse, optical or electronic aids shall be provided;
(iv) Passengers sitting down shall not interrupt sight lines in accordance with 7-2.
15-6.12 The parts of the vessel not intended for passengers, in particular access to the
wheelhouse, to the winches and to the engine rooms, shall be such that they can be secured
against unauthorized entry. At any such access, a symbol corresponding to sketch 1 in
appendix 3 shall be displayed in a prominent position.
15-6.13 Gangways shall be constructed in accordance with a recognized international
standard. By way of derogation from 10-2.1 fifth indent, their length can be less than 4 m.
15-6.14 Traffic areas intended for use by persons with reduced mobility shall have a clear
width of 1.30 m and be free of doorsteps and sills more than 0.025 m high. Walls in traffic
areas, intended for use by persons with reduced mobility shall be equipped with handrails at a
height of 0.90 m above the floor.
15-6.15 Glass doors and walls in traffic areas and also window panes shall be manufactured
from pre-stressed glass or laminated glass. They may also be made from a synthetic material,
provided this is authorized for use in a fire-protection context.
 ECE/TRANS/SC.3/172/Rev.1
page 117

Transparent doors and transparent walls extending as far as the floor on traffic areas
shall be prominently marked.
15-6.16 Superstructures or their roofs consisting completely of panoramic panes shall only be
manufactured from materials which, in the event of an accident, reduce as much as possible the
risks of injury to the persons on board.
15-6.17 Potable water systems shall, at least, comply with the requirements of 12-8
15-6.18 There shall be toilets available for passengers. At least one toilet shall be fitted for
use by persons with reduced mobility according to a relevant standard or a regulation of the
Administration and shall be accessible from areas intended for use by persons with reduced
mobility.
15-6.19 Cabins without an opening window shall be connected to a ventilation system.
15-6.20 By analogy, rooms in which crew members or shipboard personnel are
accommodated shall comply with the provisions of this section.
15-7 PROPULSION SYSTEM 4
15-7.1 In addition to the main propulsion system, vessels shall be equipped with a second
independent propulsion system so as to ensure that, in the event of a breakdown affecting the
main propulsion system, the vessel can continue to make steerageway under its own power.
15-7.2 The second independent propulsion system shall be placed in a separate engine room.
If both engine rooms have common partitions, these shall be built according to 15-11.2.

15-8 SAFETY DEVICES AND EQUIPMENT

15-8.1 All passenger vessels shall have internal communication facilities according to 7-
6.6.3. Such facilities shall also be available in the operational rooms and – where there is no
direct communication from the wheelhouse – in the muster and evacuation areas for passengers
as referred to in 15-6.8.
15-8.2 All passenger areas shall be reachable via a loudspeaker system. The system shall be
designed in such a way as to ensure that the information transmitted can be clearly distinguished
from background noise. Loudspeakers are optional where direct communication between the
wheelhouse and the passenger area is possible.
15-8.3 The vessel shall be equipped with an alarm system. The system shall include:
(i) An alarm system enabling passengers, crew members and shipboard personnel
to alert the vessel's command and crew.
This alarm shall be given only in areas assigned to the vessel’s command and
to the crew; it shall only be possible for the vessel’s command to stop the
alarm. The alarm shall be capable of being triggered from at least the
following places:
• In each cabin;

4
The Basin administration may waive the requirements prescribed in this section.
ECE/TRANS/SC.3/172/Rev.1
page 118

• In the corridors, lifts and stairwells, with the distance to the nearest trigger
not exceeding 10 m and with at least one trigger per watertight
compartment;
• In lounges, dining rooms and similar recreation rooms;
• In toilets, intended for use by persons with reduced mobility;
• In engine rooms, galleys and similar rooms where there is a fire risk;
• In the cold-storage rooms and other store rooms.
The alarm triggers shall be installed at a height above the floor of 0.85 m to
1.10 m.
(ii) An alarm system enabling the vessel's command to alert passengers.
This alarm shall be clearly and unmistakably audible in all rooms accessible to
passengers. It shall be capable of being triggered from the wheelhouse and
from a location that is permanently staffed.
(iii) An alarm system enabling the vessel’s command to alert the crew and
shipboard personnel.
The alarm system referred to in 7-5.2, shall also reach the recreation rooms for
the shipboard personnel, the cold-storage rooms and other store rooms.
Alarm triggers shall be protected against unintentional use.
15-8.4 Each watertight compartment shall be fitted with a bilge level alarm.
15-8.5 Two motor-driven bilge pumps shall be provided.
15-8.6 A bilge pumping system with permanently installed pipe work shall be available.
15-8.7 Cold storage room doors, even when locked, shall also be capable of being opened
from the inside.
15-8.8 Where CO2 bar-systems are situated in rooms below deck these rooms shall be fitted
with an automatic ventilation system. The ventilation ducts shall run down to 0.05 m from the
floor of this room.
15-8.9 In addition to the first-aid kit specified in 10-2.1, additional first-aid kits shall be
provided in sufficient number. The first-aid kits and their storage shall comply with the
requirements set out in 10-2.1, ninth indent.

15-9 LIFE SAVING APPLIANCES

15-9.1 In addition to the life jackets specified in 10-5.4.2.1 (iii) and 10-5.4.3 (ii) passenger
vessels shall be supplied with additional lifejackets for children in quantity equal to 10 % of the
total number of passengers. In addition to the lifebuoys specified in 10-5.3.4, 10-5.4.2.1 (iv) and
10-5.4.3 (iii) all parts of the deck intended for passengers and not enclosed shall be equipped
with lifebuoys on both sides of the vessel, positioned not more than 20 m apart. Lifebuoys shall
be considered as suitable if they comply with 10-5.2.3.
 ECE/TRANS/SC.3/172/Rev.1
page 119

Half of all the prescribed lifebuoys shall be fitted with a buoyant cord at least 30 m
long with a diameter of 8 to 11 mm. The other half of the prescribed lifebuoys shall be fitted
with a self-igniting, battery-powered light which will not be extinguished in water.
15-9.2 In addition to the lifebuoys referred to in 15-9.1, individual life-saving equipment
according to 10-5.4.2.1 (iii) and 10-5.4.3 (ii) shall be within reach for all shipboard personnel.
For shipboard personnel not responsible for undertaking duties according to the safety rota, not
inflatable or semi-automatically inflatable lifejackets according to the standards mentioned in 10-
5.2.2, are allowed.
15-9.3 Passenger vessels shall have appropriate equipment to enable persons to be
transferred safely to shallow water, to the bank or to another vessel.
15-9.4 In addition to the life-saving equipment referred to in 15-9.1 and 15-9.2, individual
life-saving equipment shall be available for 100 % of the maximum permitted number of
passengers. Not inflatable or semi-automatically inflatable lifejackets according to 10-5.2.2 are
also allowed.
15-9.5 The life-saving appliances shall be stowed on board in such a way that they can be
reached easily and safely when required. Concealed storage places shall be clearly marked.
15-9.6 The ship's boat shall be equipped with an engine and a searchlight.
15-9.7 A suitable stretcher shall be available.
15-9.8 For vessels with 2-compartment status or 1-compartment status and having a double
hull the Administration may reduce the aggregate capacity of collective life-saving appliances
referred to in 10-5.4.2.1 or 10-5.4.3.

15-10 ELECTRICAL EQUIPMENT

15-10.1 Only electrical equipment is permitted for lighting.
15-10.2 The provision of 9-2.13.4 applies also for passageways and recreation rooms for
passengers.
15-10.3 For the following rooms and locations, adequate lighting shall be provided:
(i) Locations where life-saving equipment is stored and where such equipment is
normally prepared for use;
(ii) Escape routes, access for passengers, including gangways, entrances and exits,
connecting corridors, lifts and accommodation area companionways, cabin
areas and accommodation areas;
(iii) Markings on the escape routes and emergency exits;
(iv) In other areas intended for use by persons with reduced mobility;
(v) Control centres, engine rooms, steering equipment rooms and their exits;
(vi) Wheelhouse;
(vii) Emergency power supply room;
ECE/TRANS/SC.3/172/Rev.1
page 120

(viii) Points at which extinguishers and fire extinguishing equipment controls are
located;
(ix) Areas in which passengers, shipboard personnel and crew muster in the event
of danger.
15-10.4 In addition to 9-2.16.6, adequate emergency lighting shall be provided for the
following rooms and locations:
(i) Escape routes, access for passengers, including gangways, entrances and exits,
connecting corridors, lifts and accommodation area companionways, cabin
areas and accommodation areas;
(ii) Markings on the escape routes and emergency exits;
(iii) In other areas intended for use by persons with reduced mobility;
(iv) Control centres, steering equipment rooms and their exits;
(v) Emergency power supply room;
(vi) Points at which extinguishers and fire extinguishing equipment controls are
located.
15-10.5 In addition to 9-2.16.5 the capacity of the emergency source shall be sufficient to
supply also:
(i) Audible warning devices;
(ii) A searchlight that can be operated from the wheelhouse;
(iii) Fire alarm system;
(iv) Lifts and lifting equipment within the meaning of 15-6.10.

15-11 FIRE PROTECTION

15-11.1 The suitability for fire protection of materials and components shall be established by
a competent body recognized by the Administration on the basis of appropriate test methods.
15-11.2 Partitions between rooms shall be designed in accordance with the following tables:
 ECE/TRANS/SC.3/172/Rev.1
page 121

Table for partitions between rooms,

in which no pressurized sprinkler systems according to 10-3.6 are installed
Rooms Control Stair- Muster Lounges Engine Gall Store
centres wells areas rooms eys rooms
Control - A0 A0/B155 A30 A60 A60 A60
centres
Stairwells - A0 A30 A60 A60 A60
Muster - A30/B156 A60 A60 A60
areas
Lounges -/B157 A60 A60 A60
Engine A60/A08 A60 A60
rooms
Galleys A0 A60/B159
Store -
rooms

Table for partitions between rooms,

in which pressurized sprinkler systems according to 10-3.6 are installed
Rooms Control Stair- Muster Lounges Engine Galleys Store
centres wells areas rooms rooms
Control - A0 A0/B155 A0 A60 A60 A30
centres
Stairwells - A0 A0 A60 A30 A0
Muster - A30/B156 A60 A60 A60
areas
Lounges -/B07 A0 A30 A0
Engine A60/A08 A60 A60
rooms
Galleys - B15
Store -
rooms


5
Partitions between control centres and internal muster areas shall correspond to Type A0, but external muster
areas only to Type B15.
6
Partitions between lounges and internal muster areas shall correspond to Type A30, but external muster areas
only to Type B15.
7
Partitions between cabins, partitions between cabins and corridors and vertical partitions separating lounges
according to 15-11.10 shall comply with Type B15, for rooms fitted with pressurized sprinkler systems B0.
8
Partitions between engine rooms according to 15-7 and 9-2.16.4 (ii), shall comply with Type A60; in other
cases, they shall comply with Type A0.
9
B15 is sufficient for the partitions between galleys, on the one hand, and cold-storage rooms or food storage
rooms, on the other.
ECE/TRANS/SC.3/172/Rev.1
page 122

(i) Type “A” partitions are bulkheads, walls and decks which satisfy the following
requirements:
• They are made of steel or of another equivalent material.
• They are appropriately stiffened.
• They are insulated with an approved non-combustible material such that
the average temperature on the side facing away from the fire rises to not
more than 140 °C above the initial temperature and at no point, including
the gaps at the joints, does a temperature increase of more than 180 °C
above the initial temperature occur within the following specified
periods:
Type A60 60 minutes
Type A30 30 minutes
Type A0 0 minutes
• They are constructed in such a way as to prevent the transmission of
smoke and flames until the end of the one-hour normal fire test.
(ii) Type-B partitions are bulkheads, walls, decks and ceilings together with
facings that meet the following requirements:
• They are made of an approved non-combustible material. Furthermore,
all materials used in the manufacture and assembly of partitions shall be
non-combustible, except for the facing, which shall be at least flame-
retardant.
• They demonstrate an insulation value such that the average temperature
on the side facing away from the fire rises to not more than 140° C above
the initial temperature and at no point, including the gaps at the joints,
does a temperature increase of more than 225 ºC above the initial
temperature occur within the following specified periods:
Type B15 15 minutes
Type B0 0 minutes
• They are constructed in such a way as to prevent the transmission of
flames until the end of the first half hour of the normal fire test.
(iii) The Administration can prescribe a test on a sample partition in order to ensure
compliance with the above provisions.
15-11.3 Paints, lacquers and other surface-treatment products as deck coverings used in
rooms except engine rooms and store rooms shall be flame-retardant. Carpets, fabrics, curtains
and other hanging textile materials as well as upholstered furniture and components of bedding
shall be flame-retardant if the rooms in which they are located are not equipped with a
pressurized sprinkler system according to 10-3.6.
15-11.4 Lounge ceilings and wall claddings, including their substructures, shall, where these
lounges do not have a pressurized sprinkler system according to 10-3.6 be manufactured from
non-combustible materials with the exception of their surfaces, which shall be at least flame-
retardant.
 ECE/TRANS/SC.3/172/Rev.1
page 123

15-11.5 Furniture and fittings in lounges which serve as muster areas shall, where the rooms
do not have a pressurized sprinkler system according to 10-3.6, be manufactured from non-
combustible materials.
15-11.6 Paints, lacquers and other materials used on exposed internal areas shall not produce
excessive amounts of smoke or toxic substances.
15-11.7 Insulation materials in lounges shall be non-combustible. This does not apply to
insulations used on coolant-carrying pipes. The surfaces of the insulation materials used on
these pipes shall be at least flame-retardant.
15-11.8 Doors in partitions according to 15-11.2 shall satisfy the following requirements:
(i) They shall satisfy the same requirements set out in 15-11.2 as the partitions
themselves;
(ii) They shall be self-closing in the case of doors in partition walls according to
15-11.10 or in the case of enclosures around engine rooms, galleys and
stairwells;
(iii) Self-closing doors which remain open in normal operation shall be such that
they can be closed from a location permanently manned by the ship’s
personnel. Once a door has been remotely closed, it shall be possible to reopen
and close it safely on the spot;
(iv) Watertight doors according to 15-2 need not be insulated.
15-11.9 Walls according to 15-11.2 shall be continuous from deck to deck or end at
continuous ceilings, which satisfy the same requirements as referred to in 15-11.2.
15-11.10 The following passenger areas shall be divided by vertical partitions as referred to in
15-11.2:
(i) Passenger areas with a total surface area of more than 800 m2;
(ii) Passenger areas in which there are cabins, at intervals of not more than 40 m.
The vertical partitions shall be smoke-tight under normal operating conditions and
shall be continuous from deck to deck.
15-11.11 Hollows above ceilings, beneath floors and behind wall claddings shall be separated
at intervals of not more than 14 m by non-combustible draught stops which, even in the event of
fire, provide an effective fireproof seal.
15-11.12 Internal stairs and lifts shall be encapsulated at all levels by walls according to 15-
11.2. The following exceptions are permissible:
(i) A staircase connecting only two decks does not need to be encapsulated, if on
one of the decks the staircase is enclosed according to 15-11.2;
(ii) In a lounge, stairs need not be encapsulated if they are located entirely within
the interior of this room, and
• If this room extends over only two decks, or
ECE/TRANS/SC.3/172/Rev.1
page 124

• If there is a pressurized sprinkler system according to 10-3.6 installed in this

room on all decks, this room has a smoke extraction system according to
15-11.15 and the room has access on all decks to a stairwell.

15-11.13 Ventilation systems and air supply systems shall satisfy the following requirements:
(i) They shall be designed in such a way as to ensure that they themselves do not
cause the spread of fire and smoke;
(ii) Openings for air intake and extraction and air supply systems shall be such that
they can be closed off;
(iii) Ventilation ducts shall be made of steel or an equivalent non-combustible
material;
(iv) When ventilation ducts with a cross-section of more than 0.02 m2 are passed
through partitions according to 15-11.2 of Type A or partitions according to
15-11.10, they shall be fitted with automatic fire dampers which can be
operated from a location permanently manned by shipboard personnel or crew
members;
(v) Ventilation systems for galleys and engine rooms shall be separated from
ventilation systems which supply other areas;
(vi) Air extraction ducts shall be provided with lockable openings for inspection
and cleaning. These openings shall be located close to the fire dampers;
(vii) Built-in ventilators shall be such that they can be switched off from a central
location outside the engine room.
15-11.14 Galleys shall be fitted with ventilation systems and stoves with extractors. The air
extraction ducts of the extractors shall satisfy the requirements according to 15-11.13 and,
additionally, be fitted with manually operated fire dampers at the inlet openings.
15-11.15 Control centres, stairwells and internal evacuation areas shall be fitted with natural or
mechanical smoke extraction systems. Smoke extraction systems shall satisfy the following
requirements:
(i) They shall offer sufficient capacity and reliability;
(ii) They shall comply with the operating conditions for passenger vessels;
(iii) If smoke extraction systems also serve as general ventilators for the rooms, this
shall not hinder their function as smoke extraction systems in the event of a
fire;
(iv) Smoke extraction systems shall have a manually operated triggering device;
(v) Mechanical smoke extraction systems shall additionally be such that they can
be operated from a location permanently manned by shipboard personnel or
crew members;
(vi) Natural smoke extraction systems shall be fitted with an opening mechanism,
operated either manually or by a power source inside the ventilator;
 ECE/TRANS/SC.3/172/Rev.1
page 125

(vii) Manually operated triggering devices and opening mechanisms shall be

accessible from inside or outside the room being protected.
15-11.16 Lounges not constantly supervised by shipboard personnel or crew members, galleys,
engine rooms and other rooms presenting a fire risk shall be connected to an appropriate fire
alarm system. The existence of a fire and its exact whereabouts shall be automatically displayed
at a location permanently manned by shipboard personnel or crew members.

15-12 FIRE-FIGHTING
15-12.1 In addition to the portable extinguishers according to 10-3.1, at least the following
portable extinguishers shall be available on board:
(i) One extinguisher for every 120 m2 of gross floor area in passenger areas;
(ii) One portable extinguisher per group of 10 cabins, rounded upwards;
(iii) One portable extinguisher in each galley and in the vicinity of any room in
which flammable liquids are stored or used. In galleys the quenching material
shall be suitable for fighting fat fires.
These additional fire extinguishers shall meet the requirements laid down in 10-3.2
and be installed and distributed on the vessel so that, in the event of a fire starting at any point
and at any time, a fire extinguisher can be reached immediately. In every galley and also in
hairdressing salons and perfumeries, there shall be a fire blanket to hand.
15-12.2 Passenger vessels shall be provided with a hydrant system referred to in 10-3.7,
consisting of:
(i) Two motor driven fire extinguishing pumps of sufficient capacity, at least one
of which is permanently installed;
(ii) One fire extinguisher line with a sufficient number of hydrants with
permanently connected fire hoses at least 20 m in length and fitted with a
standard nozzle capable of producing both a mist and a jet of water and
incorporating a shut-off facility.
For smaller vessels the Basin administration may give exemptions from these
requirements.
15-12.3 Hydrant systems shall be designed and dimensioned in such a way that:
(i) Any point of the vessel can be reached from at least two hydrants in different
places, each with a single hose length of not more than 20 m; and
(ii) The pressure at the hydrants is at least 300 kPa.
If a hydrant chest is provided, an “extinguisher hose” symbol similar to that shown in
sketch 5 in appendix 3, of at least 10 cm side length, shall be affixed to the outside of the chest.
15-12.4 Hydrant valves or cocks shall be such that they can be set so that each of the fire
hoses can be separated and removed during operation of the fire extinguishing pumps.
15-12.5 Fire hoses in the internal area shall be rolled up on an axially connected reel.
ECE/TRANS/SC.3/172/Rev.1
page 126

15-12.6 Materials for fire-fighting equipment shall either be heat-resistant or shall be suitably
protected against failure to work when subjected to high temperatures.
15-12.7 Fire-fighting systems shall be arranged in such a way that they can be completely
drained to avoid the possibility of freezing.
15-12.8 The fire pumps shall:
(i) Be located in separate rooms;
(ii) Be such that they can be operated independently of each other;
(iii) Each be capable, on all decks, of maintaining the necessary pressure at the
hydrants;
(iv) Be installed forward of the aft bulkhead.
Fire extinguishing pumps may also be used for general purposes.
15-12.9 Engine rooms shall be fitted with a fixed fire extinguishing system according to 10-
3.6.
15-12.10 On cabin vessels there shall be:
(i) Two self-contained breathing apparatus sets;
(ii) Two sets of equipment consisting of at least a protective suit, helmet, boots,
gloves, axe, crowbar, torch and safety-line; and
(iii) Four smoke hoods.

15-13 SAFETY ORGANISATION

15-13.1 A safety rota shall be provided on board passenger vessels. The safety rota describes
the duties of the crew and the shipboard personnel in the following eventualities:
(i) Breakdown;
(ii) Fire on board;
(iii) Evacuation of passengers;
(iv) Person overboard.
Specific safety measures for persons with reduced mobility shall be taken into
consideration.
The crew members and shipboard personnel designated in the safety rota should be
assigned their various duties, depending on the posts they occupy. Special instructions to the
crew shall ensure that, in the event of danger, all doors and openings in the watertight bulkheads
referred to in 15-2 shall be closed immediately.
15-13.2 The safety rota includes a safety plan, in which at least the following are clearly and
precisely designated:
(i) Areas intended for use by persons with reduced mobility;
 ECE/TRANS/SC.3/172/Rev.1
page 127

(ii) Escape routes, emergency exits and muster and evacuation areas as referred to
in 15-6.8;
(iii) Life-saving appliances and ship’s boats;
(iv) Fire extinguishers, fire hydrants and hoses and fire extinguishing systems;
(v) Other safety equipment;
(vi) The alarm system referred to in 15-8.3 (i);
(vii) The alarm system referred to in 15-8.3 (ii) and (iii);
(viii) The bulkhead doors referred to in 15-2.5 and the location of their controls, as
well as the other openings referred to in 15-2.9, 15-2.10 and 15-2.13 and 15-
3.12;
(ix) Doors pursuant to 15-11.8;
(x) Fire dampers;
(xi) Fire alarm system;
(xii) Emergency power plant;
(xiii) Ventilation system control units;
(xiv) Shore connections;
(xv) Fuel line shut-offs;
(xvi) Liquefied gas installations;
(xvii) Public address systems;
(xviii)Radiotelephone equipment;
(xix) First-aid kits.
15-13.3 The safety rota according to 15-13.1 and the safety plan according to 15-13.2 shall:
(i) Be duly stamped by the Administration; and
(ii) Be prominently displayed at an appropriate point on each deck.
15-13.4 Code of conduct for passengers shall be posted up in each cabin and also a simplified
safety plan containing only the information referred to in 15-13.2 (i) to (vi).
The instructions shall include at least:
(i) Emergency cases
• Fire
• Flooding
• General hazard
(ii) Description of various alarm signals
(iii) Information on
• Escape routes
• What to do
ECE/TRANS/SC.3/172/Rev.1
page 128

• Need to keep calm

(iv) Information to prevent accidents due to
• Smoking
• Use of fire and open flames
• Opening windows
• Use of certain items of equipment
This information shall be prominently displayed in appropriate languages.

15-14 EXEMPTIONS FOR CERTAIN PASSENGER VESSEL

15-14.1 Passenger vessels authorized to carry up to a maximum of 50 passengers and with a
length LWL of not more than 25 m, authorised to carry up to a maximum of 50 passengers shall
prove adequate stability after damage according to paragraphs 15-3.7 to 15-3.13 or, as an
alternative, prove that they comply with the following criteria after symmetrical flooding:
(i) The immersion of the vessel shall not exceed the margin line; and
(ii) The metacentric height GMR shall not be less than 0.10 m.
The necessary residual buoyancy shall be assured through the appropriate choice of
material used for the construction of the hull or by means of highly cellular foam floats, solidly
attached to the hull. In the case of vessels with a length of more than 15 m, residual buoyancy
can be ensured by a combination of floats and subdivision complying with the 1-compartment
status according to 15-3.9.
15-14.2 If a vessel benefits from the derogations under 15-14.1, the equipment carried on
board shall include – in addition to the life-saving equipment mentioned in 15-9.1 to 15-9.3 –
collective life-saving equipment according to 10-5.1, in respect of 50 % of the maximum number
of permitted passengers.
15-14.3 Where appropriate, the Administration may waive the application of 10-5.1.4 in the
case of passenger vessels intended to carry a maximum number of 250 passengers and with a
length LWL of not more than 25 m, provided that they are equipped with a suitable installation to
enable persons to be recovered safely from the water. Such installations shall be subject to the
following conditions:
(i) One person alone shall be able to operate the installation;
(ii) Mobile installations are allowed;
(iii) The installations shall be outside the danger area of the propulsion systems;
and
(iv) Effective communication shall be possible between the boatmaster and the
person in charge of the installation.
15-14.4 The Administration may waive the application of 10-5.1.4 in the case of passenger
vessels certificated to carry a maximum number of 600 passengers and with a length of not more
than 45 m, provided that the passenger vessel is equipped with a suitable installation as in 15-
14.3 and the vessel has:
 ECE/TRANS/SC.3/172/Rev.1
page 129

(i) A rudder propeller, a cycloidal propeller or a water jet as main propulsion; or

(ii) A main propulsion system with 2 propulsion units; or
(iii) A main propulsion system and a bow-thruster.
15-14.5 By way of derogation from 15-2.9, passenger vessels with a length not exceeding
45 m and permitted to carry at most a number of passengers corresponding to the length of the
vessel in metres are allowed to have on board, in the passenger area, a manually controlled
bulkhead door without remote control according to 15-2.5, if:
(i) The vessel has only one deck;
(ii) This door is accessible directly from the deck and is not more than 10 m away
from the exit to the deck;
(iii) The lower edge of the door opening lies at least 30 cm above the floor of the
passenger area; and
(iv) Each of the compartments divided by the door is fitted with a bilge level alarm.
15-14.6 The provision of 15-1.2 (v) does not apply to passenger vessels with a length not
exceeding 45 m when the liquefied gas installations are fitted with appropriate alarm systems for
CO concentrations posing a health risk and for potentially explosive mixtures of gas and air.
15-14.7 The following provisions do not apply to passenger vessels with a length LWL not
exceeding 25 m:
(i) 15-4.1 last sentence;
(ii) 15-6.6 (iii), for the galleys, as long as a second escape route is available;
(iii) 15-7.
15-14.8 For cabin vessels with a length of not more than 45 m 15-12.10 shall not be applied,
provided smoke-hoods in a number corresponding to the number of berths are readily accessible
in each cabin.
15-14.9 In addition to 1-1.8 the Administration may permit derogations for passenger vessels
on it’s own territory without the restrictions in that section for the following:
(i) 15-3.9, two-compartment status;
(ii) 15-7, second independent propulsion system; and
(iii) 15-11.15, smoke extraction systems.
15-14.10 For passenger vessels in accordance with 15-14.1 the competent authority may
permit minor derogations from the clear height required in 15-6.3 (iii) and 15-6.5 (ii).
The derogation shall not be more than 5 %. In the case of derogations the relevant parts shall be
indicated by colour.
ECE/TRANS/SC.3/172/Rev.1
page 130

CHAPTER 15A
SPECIFIC REQUIREMENTS FOR SAILING PASSENGER VESSELS
(Left void)
 ECE/TRANS/SC.3/172/Rev.1
page 131

CHAPTER 16
SPECIFIC REQUIREMENTS APPLICABLE TO VESSELS INTENDED TO FORM
PART OF A PUSHED OR TOWED CONVOY OR OF A SIDE-BY-SIDE FORMATION
16-1 VESSELS SUITABLE FOR PUSHING
16-1.1 Vessels suitable for pushing shall have at the bow a suitable pushing device so
designed and equipped that, from the start of the coupling manoeuvres:
(i) The vessel can take up a fixed position in relation to the pushed barges;
(ii) The crew can perform easily and safely the manoeuvres required for coupling
the vessel to the pushed barges.
16-1.2 Vessels suitable for pushing shall be equipped with at least two special winches or
equivalent coupling devices, which shall satisfy the following requirements:
(i) All components of the coupling device shall be capable of withstanding the
maximum operational stresses imposed under the severest conditions to be
encountered in the navigation zone for which the vessel is intended;
(ii) The coupling devices shall ensure the rigid coupling with the pushed vessel or
vessels;
Where convoys consist of a pusher vessel and a single pushed vessel, the
coupling devices may permit controlled articulation. The control systems
required for this purpose shall easily absorb the forces to be transmitted and
shall be capable of being controlled easily and safely. Sections 6-2 to 6-4 shall
apply by analogy to such control systems;
(iii) It shall be possible to couple the pusher vessel to both loaded and empty
pushed barges;
(iv) The coupling device shall be so positioned on deck as not to interfere with the
operation of other deck mechanisms, and the parts of the coupling device shall
not project beyond the vessel's breadth over-all.
16-1.3 Vessels intended to propel side-by-side formations shall be equipped with bollards or
equivalent devices the number and arrangement of which permit the formation to be securely
linked.

16-2 PUSHED BARGES

16-2.1 Chapters 5, 6, 7, sections 8-1.6.2 to 8-1.6.8 of chapter 8, section 10-2 of chapter 10,
and chapter 12 shall not apply to pushed barges with no steering system, accommodation, engine
room or boilers.
16-2.2 Ship-born barges having a length L of 40 m or less shall in addition meet the
following construction requirements:
(i) The watertight transverse bulkheads referred to in paragraph 3-4.1 shall not be
required if the forward side is capable of bearing a load at least 2.5 times that
stipulated for the collision bulkhead of an inland waterway vessel with the
same draught, built to the requirements of a recognized Classification Society;
ECE/TRANS/SC.3/172/Rev.1
page 132

(ii) Notwithstanding paragraph 8-1.6.1, double-bottomed compartments to which

access is difficult only have to be drainable if their volume exceeds 5 % of the
water displacement of the ship-born barge at the maximum authorized loaded
draught.
16-2.3 Vessels intended for use in convoys shall be equipped with coupling devices,
bollards or equivalent devices, the number and arrangement of which permit a secure link with
other vessels or vessels of the convoy.

16-3 TOWING VESSELS

16-3.1 Vessels to be used for towing operations shall meet the following requirements:
(i) Towing equipment shall be arranged in such a way that its use does not impair
the safety of the vessel, crew or the cargo;
(ii) Vessels to be used for auxiliary or main towing shall be equipped with towing
devices: a towing winch or a tow hook which shall be capable of slipping, for
the towing winch, or safe release, for the tow hook, from the steering position;
(iii) The towing devices shall be installed forward of the propeller plane. That
requirement shall not apply to vessels steered by cycloidal propellers or similar
propulsion units;
(iv) Notwithstanding the requirements of (ii) above, in the case of vessels to be
used solely for auxiliary towing, other towing devices such as a bollard, to be
installed forward of the propeller plane, may be used.
16-3.2 The Basin administration may limit the length of the vessel to be used for
downstream towing.

16-4 TESTS ON CONVOYS OF VESSELS

16-4.1 In order to issue the certificate of fitness of a pusher or a self-propelled vessel
capable of propelling a rigid convoy, and to enter relevant particulars in the certificate, the
competent authority shall decide whether and which convoys are to be presented to it for
inspection and shall carry out the navigation tests referred to in section 5-2 with the convoy in
the requested formation(s), which it considers to be least favourable. The convoy must meet the
requirements set out in sections 5-2 to 5-10.
The competent authority shall check that the rigid coupling of all the vessels in the convoy is
assured during the manoeuvres prescribed in chapter 5.
16-4.2 If, in the course of the tests referred to in section 16-4.1 above, special equipment
installed on vessels that are being pushed or led side-by-side is used, such as propelling or
manoeuvring installations or articulated couplings, in order to meet the requirements of sections
5-2 to 5-10, the following shall be mentioned in the certificate of the vessels propelling the
convoy: the formation, its position, the name and official number of the vessels making part of
the convoy and fitted with the special equipment used.
 ECE/TRANS/SC.3/172/Rev.1
page 133

16-5 ENTRIES ON THE CERTIFICATE

16-5.1 If a vessel is intended to push a convoy, or to be pushed in a convoy, the certificate
shall mention its compliance with the applicable requirements of sections 16-1 to 16-4 above.
16-5.2 The following particulars shall be entered in the certificate of the vessel intended to
ensure propulsion of another vessel or a convoy:
(i) The convoys and formations permitted;
(ii) Types of coupling;
(iii) Maximum coupling forces transmitted; and
(iv) Where appropriate, minimum tensile strength of the coupling cables for the
longitudinal connection and the number of turns of the cable on the bollard.

CHAPTER 17
SPECIFIC REQUIREMENTS APPLICABLE TO FLOATING EQUIPMENT

(Left void)

CHAPTER 18
SPECIFIC REQUIREMENTS APPLICABLE TO WORKSITE CRAFT

(Left void)

CHAPTER 19
SPECIFIC REQUIREMENTS APPLICABLE TO HISTORIC VESSELS

(Left void)

CHAPTER 19A
SPECIFIC REQUIREMENTS APPLICABLE TO CANAL BARGES

(Left void)

CHAPTER 19B
SPECIFIC REQUIREMENTS APPLICABLE TO CRAFT NAVIGATING ON ZONE 4

(Left void)
 ECE/TRANS/SC.3/172/Rev.1
page 135

CHAPTER 20
SPECIFIC REQUIREMENTS APPLICABLE TO SEA-GOING SHIPS

20-1 GENERAL

20-1.1 Sea-going ships covered by the International Convention for the Safety of Life at Sea
of 1974 (SOLAS 1974) or the International Convention on Load Lines of 1966 shall carry a
valid corresponding international certificate.

20-1.2 Sea-going ships not covered by SOLAS 1974 or the International Convention of
Load Lines 1966 must carry the certificates and bear the freeboard marks required by the laws of
their States of registry, and shall meet the requirements of the Convention in respect of
construction, rigging and gear, or otherwise ensure a comparable safety level.

20-1.3 Sea-going ships covered by the International Convention for the Prevention of
Pollution from Ships of 1973 (MARPOL 73) shall carry a valid international oil pollution
prevention certificate (IOPP certificate).

20-1.4 Sea-going ships not covered by MARPOL 73 shall carry a valid corresponding
certificate required by the laws of their flag State.

20-1.5 In addition, the following shall be applicable:

(i) Chapter 5;
(ii) From Chapter 6:
Articles 6-1.1, 6-2.1, 6-2.2;
(iii) From Chapter 7:
Article 7-1.5, Article 7-2.1, Article 7-2.2, paras. 1 and 4, Article 7-6.7 for sea-
going ships approved for radar-steering by one person;
(iv) From Chapters 8 and 8B:
Article 8-1.1.6 for sea-going ships, when an automatic shutdown can be
deactivated from the wheelhouse; Article 8-1.5.12, Article 8B-1.5, Articles 8B-
1.2 and 8B-1.6; and Article 8B-8.
A seal for the closing devices required under Article 8B-1.5 shall be considered
equivalent to a shut-off for the closing devices of the drainage system for
pumping oily water overboard. The necessary key or keys shall be kept in a
properly marked central location.
An oil discharge monitoring and control system in accordance with regulation
16 of MARPOL 73/78 shall be considered to be equivalent to the sealing of
closing devices prescribed in Article 8B-1.5. An international certificate
concerning the prevention of oil pollution in accordance with MARPOL 73/78
shall provide evidence of the presence of the monitoring and control system.
If it is indicated in the IOPP certificate mentioned under 20-1.3, above, or the
national certificate issued by the State of registry mentioned under 20-1.4
above, that the ship is equipped with waste tanks sufficient to hold on board all
ECE/TRANS/SC.3/172/Rev.1
page 136

oily water and residues, it shall be considered that there is compliance with
Article 8B-1.6;
(v) From Chapter 9:
Article 9-2.14;
(vi) From Chapter 10:
Section 10-1 (except 10-1.2.2 and 10-1.3.3) and Article 10-2.1;
(vii) Chapter 16, for sea-going ships approved as part of a convoy;
(viii) Chapter 22:
Chapter 22 shall be considered to have been complied with when stability is in
conformity with the Resolutions of the International Maritime Organization
(IMO) in force, when the relevant documents relating to stability have been
stamped by the competent authority and when the containers are secured in the
manner usual in maritime shipping.

20-2 MINIMUM CREW

20-2.1 Chapter 23 shall apply in determining the minimum crew for sea-going ships.

20-2.2 As an exception to 20-2.1, sea-going ships may continue to sail with the crew
arrangements set out in the provisions of IMO Resolution A.481 (XII) and the International
Convention on Standards of Training, Certification and Watchkeeping for Seafarers of 1978,
provided that the number of the crew is not less than the minimum crew detailed in chapter 23
for operating mode B, and particularly Articles 23-9 and 23-13.

The relevant documents, which set out the qualifications of crew members and their
number, shall be kept on board. A person in possession of the boatmaster’s certificate, valid for
the section travelled, shall also be on board. The boatmaster shall be replaced by another
boatmaster certificate-holder after a maximum of 14 hours’ navigation in any 24-hour period.
The following particulars shall be entered in the ship’s log:
(i) Name of the boatmaster certificate-holders on board, along with the beginning
and end of their watch;
(ii) Beginning and interruption, resumption and end of the voyage, with the
following particulars: date, time and place and kilometre post.
 ECE/TRANS/SC.3/172/Rev.1
page 137

CHAPTER 21
SPECIFIC REQUIREMENTS APPLICABLE TO RECREATIONAL CRAFT

21-1 GENERAL

21-1 (i) For the purpose of this Chapter, the term “recreational craft” means a vessel,
other than passenger vessels, intended for sport and pleasure and of a length of
20 meters and more;
(ii) Only Articles 21-2 and 21-3 apply to the construction, equipment and manning
of recreational vessels.

21-2 REQUIREMENTS TO RECREATIONAL VESSELS

21-2.1 Recreational vessels shall meet the following requirements:

(i) From Chapters 3 and 4:

Article 3-1.1, Article 3-1.2, first paragraph, Articles 3-4.1.1, 3-4.1.2, 3-4.1.3 and
4-4.3.7;
(ii) Chapter 5;
(iii) From Chapter 6:
Article 6-1.1 and Article 6-8;
(iv) From Chapter 7:
Article 7-1.5, Article 7-2, Articles 7-3.1 and 7-3.2, Article 7-1.1, Article 7-1.6,
Article 7-6.7 [if there is a wheelhouse designed for radar navigation by one
person];
(v) From Chapters 8 and 8B:
Article 8-1.1.1, first paragraph, 8-1.1.3 and 8-1.1.4, Articles 8-1.1.6, 8-1.3.1
and 8-1.3.2, Article 8-1.4, Article 8-1.5.1, Article 8-1.5.2 second sentence,
Article 8-1.5.6, Article 8-1.5.9, Article 8-1.5.10, Article 8-1.5.11, Article 8-
1.5.12, Article 8-1.5.13 second sentence, Article 8-1.6.1, Article 8-1.6.2,
Article 8-1.6.5, Article 8-1.6.7, Article 8B-1.5, Article 8B-1.2 and Article 8B-
8;
(vi) From Chapter 9:
Article 9-1.1.1, mutatis mutandis;
(vii) From Chapter 10:
Article 10-1.2.1, the last paragraph or Article 10-1.2.2, Articles 10-1.3.1 and
10-1.3.3, Article 10-1.2.3, Article 10-1.1.3, Article 10-1.1.2, Article 10-1.5.1,
the last sentence, Article 10-1.4.1 and 10-1.4.2, Article 10-1.4.3, Article 10-
1.4.4, Article 10-2.1, first, second and twelfth bullet points, Article 10-1.4.5,
Article 10-2.1 third, seventh, ninth and tenth bullet points, Article 10-3.1,
subparagraphs (i), (ii), (iv), however, there shall be at least two fire
extinguishers on board; Article 10-3.2 and Article 10-3.5. 10-3.7 and 10-3.8,
Articles 10-5.4.2 and 10-5.4.3; a fixed fire-extinguishing installation, if fitted,
shall comply with Article 10-3.6, and an automatic fire detection system – with
Article 8-2.6.
ECE/TRANS/SC.3/172/Rev.1
page 138

(viii) Chapter 14;

(ix) Chapter 22B:
Article 22B-5.1.
21-2.2 For recreational vessels (between 20 m and 24 m) subject to international regulations
and standards for recreational vessels to be placed on the European market, first inspection and
periodical inspections only extend to:

(i) Article 6-8, if there is a rate-of-turn indicator;

(ii) Article 7-1.5, Article 7-2, Article 7-3.1, and Article 7-6.7 if there is a
wheelhouse designed for radar navigation by one person;
(iii) Articles 8-1.1.3 and 8-1.1.4, Article 8-1.3.1, Article 8-1.1.6, Article 8-1.5.10,
the last sentence, Article 8-1.6.2 and Article 8B-8;
(iv) Article 10-1.2.1, the last paragraph, Article 10-1.2.2, Articles 10-1.3.1 and 10-
1.3.3, Article 10-1.2.3, Article 10-1.4.4, Article 10-2.1, first and second
subparagraphs 1, 2, Article 10-1.4.5, Article 10-2.1 subparagraphs third,
seventh, ninth, tenth, Article 10-3.1, subparagraphs (ii) and (iv); 10-3.2 and
Article10-3.5, Articles 10-5.4.2 and 10-5.4.3;
(v) From Chapter 14:
(a) Article 14-12;
(b) Article 14-13; the acceptance test after putting into service of the
liquefied gas installation shall be carried out in accordance with the
requirements of international regulations and standards for recreational
vessels to be placed on the European market, and an acceptance report
shall be submitted to the inspection body;
(c) Articles 14-14 and 14-15; the liquefied gas installation shall be in
accordance with the requirements of international regulations and
standards for recreational vessels to be placed on the European market;
(d) Chapter 14 entirely, if the liquefied gas installation is fitted after placing
the recreational vessels on the market.

21-3 APPLICABILITY OF CHAPTER 23

21-3.1 Chapter 23 is not applicable. The crew shall consist of:

(i) A boatmaster with the appropriate certificate;

(ii) A person who can help with ship’s manoeuvring.
 ECE/TRANS/SC.3/172/Rev.1
page 139

CHAPTER 22
STABILITY OF VESSELS CARRYING CONTAINERS
22-1 GENERAL
22-1.1 A cargo of containers is considered to be fixed when each individual container is
firmly secured to the vessel hull by guides or tensioners and when its position cannot be altered
during navigation.
22-1.2 The container cargo of vessels navigating in zone 1 must be fixed.
22-1.3 The equipment used to secure containers must satisfy the requirements laid down by
the Administration.
22-1.4 The following two methods of calculation of stability of vessels carrying containers
shall be considered as equally acceptable.

22-2 METHOD A
22-2.1 Stability calculation for vessels carrying non-fixed containers
22-2.1.1 In the case of the vessels carrying non-fixed containers any calculation method used
to determine the vessel's stability shall conform to the following requirements:
(i) The metacentric height MG shall not be less than 1.00 m;
(ii) Under the combined action of the centrifugal force produced by the turning of
the vessel, the thrust of the wind and the flooded free surfaces, the heel shall
not be more than 5° and the deck side shall not be submerged.
22-2.1.2 The heeling arm resulting from the centrifugal
v2 T'
force due to the turning of the vessel shall be determined by hcf = Ccf ⋅ ⋅ ( KG − ) (m)
the following formula: LWL 2
Where: Ccf= parameter: (Ccf = 0.04) (s2/m);
v = maximum speed of vessel in relation to
the water (m/s);
KG = height of centre of gravity of loaded
vessel above the baseline (m);
T' = average draught of loaded vessel (m).
22-2.1.3 The heeling arm resulting from the static effect of Aw T'
hwst = Cw ⋅ ⋅ ( l w + ) ( m)
wind shall be determined according to the following formula: Δ 2
Where: Cw = parameter: (CW = 0.025) [t/m2];
lw = height of centre of gravity of lateral
surface Aw above the water in relation to
the water-line (m);
T' = average draught of loaded vessel (m).
ECE/TRANS/SC.3/172/Rev.1
page 140

22-2.1.4 The heeling arm resulting from the free surfaces exposed to rainwater and residual
water inside the hold or double bottom shall be determined according to the following formula:
C fs
h fs = ⋅ ¦ (b ⋅ 1 ⋅ (b − 0.55 b ) (m)
Δ
where: Cfs = parameter: (Cfs = 0.015) [t/m2];
b = breadth of hold or section of hold concerned (m);
l = length of hold or section of hold concerned (m).
22-2.1.5 For each load, half the fuel and freshwater supply must be taken into account.
22-2.1.6 The stability of a vessel loaded with non-fixed containers shall be considered
adequate when the actual KG is not more than the KGmax produced by the formula. The
KGmax must be calculated for various displacements covering the whole range of possible
draughts:
B T
KM + WL ⋅ (C 'cf ⋅ a − hwst − h fs )
(i) KGmax = 2F 2 (m )
Bf
⋅ C 'cf + 1
2F
B
For WL , no value below 11.5 shall be used (11.5 = 1/tan 5˚);
2F
(ii) KGmax = KM −1.00 ( m )
The smaller value for KGmax produced by subparagraphs (i) or (ii) shall apply,

where: KGmax = maximum permissible height of the centre of gravity of the loaded vessel
above the baseline (m);
KM = metacentric height above the baseline (m) according to the approximation
formula in 22-2.1.7;
F = actual freeboard at 1/2 L (m);
C'cf = parameter for centrifugal force produced by turning;
( 0 .7 ⋅ v ) 2 v2
C 'cf = = 0.04 ⋅ [−]
9.81⋅1.25 ⋅ LF LF
v = maximum speed of vessel in relation to the water (m/s);
Ta = average draught (m);
hwst = heeling arm resulting from the static effect of wind (see 22-2.1.3) (m);
hfs = sum of heeling arms produced by flooded free surfaces (see 22-2.1.4) (m).

22-2.1.7 Approximation formula for KM :

Where there is no curve plan available, the value of KM for the calculation,
according to 22-2.1.6 and 22-2.2.4 can be determined, for example, by the following
approximation formulae:
 ECE/TRANS/SC.3/172/Rev.1
page 141

(i) Pontoon vessels: (ii) other vessels:

2 2
BWL T BWL T
KM = + a ( m) KM = + a ( m)
T 2 T 2
(12.5 − a ) ⋅Ta (12.7 − 1.2 ⋅ a ) ⋅ Ta
H H
22-2.2 Stability calculation for vessels carrying fixed containers
22-2.2.1 In the case of vessels carrying fixed containers, any calculation method used to
determine the stability of the vessel shall conform to the following requirements:
(i) The metacentric height MG shall not be less than 0.50 m;
(ii) Under the combined action of the centrifugal force produced by the turning of
the vessel, the thrust of the wind and the flooded free surfaces, no hull opening
shall be submerged.
22-2.2.2 The heeling arm resulting from the centrifugal force produced by the turning of the
vessel, the thrust of the wind and the flooded free surfaces shall be determined by the formulae
referred to under paragraphs 22-2.1.2 – 22-2.1.4.
22-2.2.3 For each load, half the fuel and fresh water supply must be taken into account.
22-2.2.4 The stability of a vessel loaded with fixed containers shall be considered adequate
when actual KG is less than or equal to the KGmax calculated for the various displacements
resulting from the possible variation in height.

22-3 METHOD B
22-3.1 Stability calculation for vessels carrying non-fixed containers
22-3.1.1 The stability of vessels carrying non-fixed containers must satisfy the following
additional requirements:

22-3.1.2 The metacentric height MG shall not be less than 1.00 m.

22-3.1.3 The permissible angle of heel ϕ perm is compared with the angle of heel ϕ wst / cf
resulting from the combined effect of the heeling moments produced by the static pressure of
wind Mwst (see paragraph 15-3.5) and the effect of the centrifugal force on turning Mcf. In
calculating Mcf in accordance with paragraph 15-3.6 the speed of the vessel before it begins its
turn is taken as 0.8 of the maximum speed. This angle must not be greater than 5° or the critical
angle ϕn at which the upper edge of the freeboard deck is submerged, with a view to determining
which of these angles is the smaller; in other words one of the following requirements must be
satisfied:
ϕ wst / cf ≤ ϕ perm = 5$ or ϕ wst / cf ≤ ϕ perm = ϕ n , if ϕ n < 5$

22-3.1.4 The angle of heel ϕ wst / cf should be determined from the static stability diagram in
relation to the value of Mwst and Mcf as a result of constructions given in figure 22-3.1.4 where
the origin of the coordinates is transposed to point O' on curve M, corresponding to the static
angle of heel ϕwst, arising as a result of the application of the static moment Mwst, determined in
accordance with 15-3.5.
ECE/TRANS/SC.3/172/Rev.1
page 142

The angle of heel ϕ wst / cf is determined by selecting a straight line BD parallel to the
ordinates axis, assuming that the hatched areas O'CA above the curve up to the moment Mcf and
ABD below the curve are equal.
M 22-3.1.5 In determining the permissible
M moment produced by the dynamic
inclinations Mperm, the permissible angle of
heel ϕperm must be no greater than that given
in paragraph 22-3.1.3.
22-3.1.6 If the requirements laid down in
Mcf B paragraphs 22-3.1.3 and 22-3.1.5 are not
CA satisfied containers must be secured.
D
O' ϕo 22-3.2 Stability calculation for vessels
carrying fixed containers
0 5 10 15
Mwst ϕ wst 22-3.2.1 The requirement regarding the
ϕ wst/cf stability of vessels carrying fixed containers
is considered to be met, if the criteria for the
ϕ perm Figure 22-3.1.4 stability of cargo vessels set out in paragraph
3-5.3.2 have been satisfied.

CHAPTER 22A
SPECIFIC REQUIREMENTS APPLICABLE TO CRAFT LONGER THAN 110 M
(Left void)
 ECE/TRANS/SC.3/172/Rev.1
page 143

CHAPTER 22B
SPECIFIC REQUIREMENTS APPLICABLE TO HIGH-SPEED VESSELS
22B-1 GENERAL
22B-1.1 High-speed vessels shall not be built as cabin vessels.
22B-1.2 High-speed vessels shall be built under the supervision of a recognized Classification
Society with rules intended for high-speed vessels in accordance with its classification
requirements. The class assigned by a recognized Classification Society shall be maintained for
the whole operation period of the vessel.
22B-1.3 Chapters 1 to 4, 6 to 12, 15 and 23 of the present Recommendations apply to high-
speed vessels, unless otherwise specified in the present chapter.

22B-2 SEATS AND SEAT BELTS

22b-2.1 Seats shall be available for the permitted maximum number of persons on board.
The construction of the seats and their attachment to the vessel structure shall be sufficiently
strong.
22b-2.2 Seats shall be fitted with seat belts. The seat belts and their attachment points shall
be sufficiently strong. Seat belts are optional if Basin administrations consider that they are not
required.

22B-3 FREEBOARD
The minimum freeboard shall be 500 mm for open vessels (type C) and 200 mm for decked
vessels (type A).

22B-4 BUOYANCY, STABILITY AND SUBDIVISION

22B-4.1 A vessel shall be provided with stability characteristics and stabilization systems
adequate for safety when the vessel is operated in the non-displacement mode and during the
transitional mode.
22B-4.2 A vessel shall be provided with buoyancy and stability characteristics adequate for
safety when the vessel is operated in the displacement mode, both in the intact condition and the
damaged condition.
22B-4.3 A vessel shall be provided with stability characteristics in the non-displacement and
transitional modes adequate to transfer the vessel safely to displacement mode in case of any
system malfunction.

22B-5 WHEELHOUSE
22B-5.1 The wheelhouse shall be so equipped that the helmsman and a second crew member
can at all times perform their tasks while the vessel is under way.
22B-5.2 The wheelhouse shall be equipped in such a way as to provide the helmsman and a
second crew member with a work station. The equipment for navigation, manoeuvring,
supervision and data transmission and other appliances with an important role in the operation of
ECE/TRANS/SC.3/172/Rev.1
page 144

the vessel shall be placed sufficiently close together to enable a second crew member while
seated to have access to the necessary data and to make use as the need arises of control
equipment and installations.
22B-5.3 The helmsman and a second crew member shall be able to control the equipment
referred to in paragraph 22B-5.2 without hindrance, including when seated wearing correctly
fastened seat belts.
22B-5.4 The steering station shall be so designed as to conform to paragraphs 7-6.1 to 7-6.7.
22B-5.5 Whatever the laden state, the blind area of vision forward of the bow from a seated
position shall not be greater than the length of the vessel. When the blind area of vision exceeds
the length of the vessel, a table indicating the length of the blind area and the time of crossing it,
depending on the speed of the vessel, shall be located in the wheelhouse at a clearly visible
place.

22B-5.6 The total arc of blind sectors from right ahead to 22.5° abaft the beam on either side
shall not exceed 20°. Each individual blind sector shall not exceed 5°. The clear sector between
two blind sectors shall not be less than 10°.
22B-5.7 Windows shall be designed to minimize unwanted reflections. Installations to
prevent dazzling by the sun shall be provided.
22B-5.8 Surface materials used in the wheelhouse shall avoid reflections.

22B-6 SAFETY INFORMATION

22B-6.1 All passenger vessels shall be equipped with means of providing acoustic and visual
information on safety measures that are audible and visible to all passengers.
22B-6.2 The means referred to in paragraph 22B-6.1 shall enable the master to give
instructions to the passengers.
22B-6.3 In the vicinity of each passenger seat there shall be instructions concerning
emergency situations, including in particular an overall sketch of the vessel on which are marked
all the exits, evacuation routes, emergency and rescue equipment and containing instructions on
the use of life-jackets.

22B-7 EXITS AND EVACUATION ROUTES

22B-7.1 An easy, safe and rapid access shall be ensured from the wheelhouse to the spaces
and accommodation accessible to the public.
22B-7.2 The evacuation routes leading to the safety exits shall be indicated clearly and
permanently.
22B-7.3 All concealed exits shall be adequately indicated. The means of operating the
opening mechanisms of exit doors shall be clearly visible from the outside and from the inside.
22B-7.4 An adequate space shall be provided beside the exits for a crew member.
 ECE/TRANS/SC.3/172/Rev.1
page 145

22B-8 FIRE PROTECTION

22B-8.1 Corridors, spaces and accommodation accessible to the public, galleys and engine
rooms shall be connected to an efficient fire alarm system. Any outbreak of fire and its location
shall be automatically communicated to a point permanently occupied by members of the crew.
22B-8.2 The following installations are prohibited on board high-speed vessels:
(i) Appliances with wick burners;
(ii) Vaporizing oil-burner stoves;
(iii) Solid fuel heating appliances;
(iv) Liquefied gas installations.

22B-9 ADDITIONAL REQUIREMENTS

Spaces and accommodation accessible to the public and their equipment shall be so
designed as to ensure that persons making normal use of them cannot be injured during a normal
start or stop, an emergency start or stop or during manoeuvres and under normal sailing
conditions, particularly in the event of a breakdown or the erroneous activation of a control.
 ECE/TRANS/SC.3/172/Rev.1
page 147

CHAPTER 23
CREWS
23-1 GENERAL
23-1.1 These Recommendations apply to all inland navigation vessels engaged in
international shipping, except unmanned pushed barges and small craft within the meaning of the
European Code for Inland Waterways (CEVNI).
23-1.2 Minimum crews on board inland navigation vessels shall conform to the
requirements of these recommendations for all operating modes. The recommendations do not
preclude competent authorities from prescribing any additional personnel which may be needed
in special cases such as the transport of dangerous goods.
23-1.3 The minimum crew prescribed for the operating modes shall be on board the vessel
at all times when it is under way. No departure shall be permitted without the prescribed
minimum crew.

23-2 CREW MEMBERS

23-2.1 The minimum crew of a vessel, ensuring the safety of its operation, may consist of
the following crew members:
(i) Boatmasters;
(ii) Helmsmen;
(iii) Able crewmen;
(iv) Ordinary crewmen;
(v) Engineers;
(vi) Electrician-engineers;
(vii) Engine-minders;
(viii) Radio operators. 10
23-2.2 On inland waterways, where national or international legislation so allows, the
minimum crew of vessels, ensuring the safety of its operation may also include apprentices and
deck-hands.
23-2.3 The qualifications for crew members shall be as follows:
23-2.3.1 Boatmaster:
Shall hold a boatmaster's certificate issued in accordance with the Recommendations
on Minimum Requirements for the Issuance of Boatmaster's Certificates in Inland Navigation
with a view to their Reciprocal Recognition for International Traffic (Resolution No. 31 of
12 November 1992, revised).


10
In accordance with the national rules of the Russian Federation and Ukraine only.
ECE/TRANS/SC.3/172/Rev.1
page 148

23-2.3.2 Helmsman:
Shall be not less than 17 years of age and
(i) Shall have had not less than one year’s experience in inland navigation as an
able crewman or not less than three years’ experience as an ordinary crewman
within the meaning of 23-2.3.4 (ii), or
(ii) Shall have successfully completed training provided the training includes
experience in inland navigation as a helmsman-apprentice or as an ordinary
crewman for a period determined by the competent authority.
23-2.3.3 Able crewman:
(i) Shall have had not less than one year’s experience in inland navigation as an
ordinary crewman and
• Have successfully completed the training referred to in 23-2.3.5 below, or
• Have passed the final examination of a professional college of inland
navigation, or
• Have passed any other examination for ordinary crewman recognized by the
competent authority, or
(ii) Shall have successfully completed training referred to in 23-2.3.5 below of a
duration of not less than three years or have passed a final examination
following training of not less than three years in a professional college of
inland navigation provided the training includes not less than one year’s
experience in inland navigation, or
(iii) Shall have had not less than two years’ experience in inland navigation as an
ordinary crewman within the meaning of 23-2.3.4 (ii).
23-2.3.4 Ordinary crewman:
(i) Shall be not less than 17 years of age and
• Have passed an examination on completion of the training referred to in
23-2.3.5 below, or
• Have passed an examination on completion of training in a professional
college of inland navigation, or
• Have passed any other examination for ordinary crewman recognized by the
competent authority, or
(ii) Shall have had not less than three years’ experience as a member of the ship's
deck department, including not less than one year in inland navigation and two
years either in inland navigation or at sea, in coastal navigation or fishing.
23-2.3.5 Apprentice:
Shall be not less than 15 years 11 of age and have an apprentice’s contract which
provides for attendance at a professional college of inland navigation or for a correspondence
course approved by the competent authority to be taken in the preparation of an equivalent
diploma.
23-2.3.6 Deck-hand:
Shall be not less than 16 years of age.

11
The age limitation of an apprentice may be higher depending on national legislation.
 ECE/TRANS/SC.3/172/Rev.1
page 149

23-2.3.7 Engineer:
(i) Shall be at least 18 years of age and have passed an examination on completion
of a full training course in the engine and mechanics sectors, or
(ii) Shall have worked for not less than two years as an engine-minder on a
motorized inland navigation vessel.
23-2.3.8 Electrician-engineer:
(i) Shall be at least 18 years of age and have passed an examination on completion
of a full training course in on-board electrical systems; or
(ii) Shall be at least 18 years of age and have experience of working in a ship’s
crew for a period determined by the competent authority.
23-2.3.9 Engine-minder:
Shall be not less than 17 years of age and either
(i) Be an ordinary crewman and have passed an engine-minder’s examination
recognized by the competent authority, or
(ii)
Have had not less than one year’s experience on board a motorized inland
navigation vessel as an ordinary crewman and have a basic knowledge of
engines.
23-2.3.10 Radio operator:
Shall be at least 18 years of age, have passed an examination on completion of a full
training course in on-board radio systems and have navigational experience as part of a vessel
crew for a period determined by the competent authority, or have completed an appropriate
probationary period of at least two months’ duration aboard inland navigation vessels.

23-3 CREW MEMBERS - PHYSICAL FITNESS

23-3.1 Physical fitness for the job shall be certified by a medical certificate issued on first
enlistment as a crew member by a doctor designated by the competent authority.
23-3.2 Physical fitness involves in particular:
(i) Adequate eyesight and hearing;
(ii) The capacity to lift a weight of 20 kg unaided. 12
23-3.3 Certification of fitness in accordance with 23-3.1 and 23-3.2 above shall be renewed
periodically in accordance with the requirements of the Administration.
23-3.4 Where a competent authority has doubts as to the physical fitness of a crew member,
it may request a medical examination in accordance with the provisions of 23-3.1 and 23-3.2.

23-4 PROOF OF QUALIFICATIONS - SERVICE RECORD

23-4.1 Every member of the minimum crew shall have a personal service record conforming
to the model reproduced in the appendix 5 to these Recommendations. All the essential
information required in the service record should be printed as a minimum, in the official

12
The competent authority may waive this requirement or prescribe additional requirements with regard to
physical fitness.
ECE/TRANS/SC.3/172/Rev.1
page 150

language of the country concerned and either in French, German or Russian. On enlistment, the
service record shall be presented to the boatmaster and kept up to date and carefully preserved by
him/her until discharge. The service record shall be returned to the holder on request at any time
and without delay.
The service record contains general information such as diplomas obtained, medical
certificates and the holder's qualifications under section 23-2, as well as specific information
concerning voyages made or positions held during service on board vessels.
23-4.2 The holder of the service record shall have the record certified at least once in the
course of the 12-month period following the date of issue by a competent local authority.
23-4.3 The authority referred to in 23-4.2 above shall be responsible for entering the general
information referred to in 23-4.1 above. The boatmaster shall be responsible for entering the
specific information referred to in 23-4.1 above. The particulars concerning the preceding
voyage shall be entered before the start of the next voyage. The instructions concerning the
keeping of the service record and the definitions (e.g. “voyage”, start and finish) are to be found
in the service record.
23-4.4 For crew members holding a boatmaster's certificate in accordance with the
Recommendations on Minimum Requirements for the Issuance of Boatmaster's Certificates in
Inland Navigation with a view to their Reciprocal Recognition for International Traffic
(Resolution No. 31 of 12 November 1992, revised), such certificate shall stand in lieu of the
service record.
23-4.5 It shall be possible to provide proof of qualification for employment on board at any
time:
23-4.5.1 for the boatmaster, in the form of the boatmaster's certificate;
23-4.5.2 for the helmsman, able crewman, ordinary crewman, engineer or engine-minder in
the form of the service record or the boatmaster's certificate.
23-4.6 For crew members who hold a certificate or proof of qualifications and appear on the
crew list in accordance with national regulations of the country the waterways of which they
navigate, such certificates and proof of qualifications shall stand in lieu of the service record
provided that the service record is not prescribed by national or international law concerning the
navigation on inland waterways they navigate.
23-5 OPERATING MODES 13
A distinction shall be made between the following operating modes:

A1 daytime navigation for a maximum of 14 hours 14

per 24-hour
A2 semi-continuous navigation for not more than 18 hours
period
B continuous navigation for 24 hours and more

13
On certain river basins competent authorities may prescribe operating modes which differ from those
indicated in section 23-5.
14
Daytime navigation may be extended to a maximum of 16 hours, not more than once a week, if the vessel is
equipped with a tachograph approved by the Administration and in proper working order, and if the members of the
minimum crew include one holder of the boatmaster’s certificate and a helmsman.
 ECE/TRANS/SC.3/172/Rev.1
page 151

A vessel navigating under mode A1 or mode A2 shall cease navigation for 8 hours
continuously, in the former case, and 6 hours continuously, in the latter case, if the vessel is
equipped with a tachograph of a type approved by the Administration and in proper working
order. In the other cases, a vessel sailing under mode A1 shall cease navigation for the whole of
the period between 10 p.m. and 6 a.m., and a vessel under mode A2 between 11 p.m. and 5 a.m.

23-6 MANDATORY REST PERIOD

23-6.1 In operating mode A1, all members of the crew shall have eight hours of
uninterrupted rest outside sailing time for each 24-hour period, calculated from the end of each
8-hour rest period.
In operating mode A2, all crew members shall have eight hours’ rest including six
hours uninterrupted rest time outside sailing times 15 for each 24-hour period, calculated from the
end of each 6-hour rest period.
In operating mode B, all crew members shall have 24 hours' rest time per 48-hour
period including at least two 6-hour periods of uninterrupted rest.
During the mandatory rest time, a crew member may not be called on to perform any
duty, including surveillance or standby; the watch and surveillance duties provided for in the
European Code for Inland Waterways (CEVNI) for stationary vessels shall not be considered as
an obligation under this paragraph.
23-6.2 The provisions of labour regulations and in collective agreements concerning longer
rest periods shall remain valid.

23-7 CHANGE OR REPETITION OF OPERATING MODE

23-7.1 A change or repetition of operating mode may take place only if the following
requirements are complied with:
(i) The change-over from operating mode A1 to mode A2 may take place only if:
• The crew has been entirely replaced, or
• The crew members required for operating mode A2 have completed,
immediately prior to the change, an 8-hour rest period, including six hours
outside sailing-time, and the extra crew required for operating mode A2 are
on board.
(ii) The change-over from operating mode A2 to mode A1 may take place only if:
• The crew has been entirely replaced, or
• The crew members required for operating mode A1 have completed,
immediately prior to the change, an uninterrupted rest period of eight hours
outside sailing-time.
(iii) The change-over from mode B to mode A1 or A2 may take place only if:
• The crew has been entirely replaced, or


15
For all crew members under 18, eight hours of uninterrupted rest including six hours outside sailing times.
ECE/TRANS/SC.3/172/Rev.1
page 152

• The crew members required for operating modes A1 and A2 have completed,
immediately prior to the change, 8-hour and 6-hour uninterrupted rest
periods, respectively.
(iv) The change-over from operating mode A1 or A2 to mode B may take place only
if:
• The crew has been entirely replaced, or
• The crew members required for operating mode B have completed,
immediately prior to the change, 8-hour and 6-hour uninterrupted rest
periods, respectively, outside sailing time and the extra crew required for
mode B are on board.
23-7.2 A repetition from operating mode A1 or A2 may take place only if:
• The crew has been entirely replaced, and
• The crew members required for the repeated mode A1 or A2, have completed,
immediately prior to the change, 8-hour or 6-hour uninterrupted rest periods
respectively, outside sailing time.
23-7.3 In all cases of change of operating mode, the shipowner shall amend the crew
manning table in line with the minimum requirements governing crew composition and bring the
crew up to strength in accordance with the new manning table prior to changing the operating
mode.

23-8 SHIP'S LOG, TACHOGRAPH

23-8.1 A ship’s log conforming to the requirements of the Administration shall be kept on
board each vessel to which the provisions of present Recommendations apply in accordance with
section 23-1 above. The ship's log shall be kept in accordance with the instructions it contains.
The responsibility for keeping the ship's log and making the necessary entries in it shall devolve
on the boatmaster. The first ship's log, which shall bear the number 1, the name of the vessel and
its official number, shall be issued by the authority which issued the ship's certificate.
The beginning and end of rest periods shall be entered each day during the voyage.
The particulars relating to a change of operating mode shall be entered on a fresh
page of the ship's log.
23-8.2 Subsequent ship's logs may be issued by a competent local authority which shall
affix to them their serial number; however, they may be issued only on production of the
preceding log. The preceding log shall be marked indelibly “cancelled” and returned to the
boatmaster.
23-8.3 The cancelled log shall be kept on board for six months following the last entry.
23-8.4 On issue of the first ship's log in accordance with 23-8.1, the authority issuing it shall
certify that it has done so by means of a certificate indicating the name of the vessel, its official
number, the number of the ship's log, and the date of issue. This certificate shall be kept on
board and be produced on request. The issue of subsequent ship's logs in accordance with 23-8.2
shall be entered by the competent authority on the certificate.
 ECE/TRANS/SC.3/172/Rev.1
page 153

23-8.5 Tachograph recordings shall be kept on board for six months following the last entry
if the vessel is equipped with a tachograph.

23-9 EQUIPMENT OF VESSELS

23-9.1 Notwithstanding the other provisions of these Recommendations, self-propelled
vessels, self-propelled pusher vessels, pushers, pushed convoys and passenger vessels operated
with a minimum crew shall meet the following requirements:
(i) The propulsion equipment shall be so arranged as to enable the speed to be
changed and the direction of propulsion reversed from the vessel's steering
station.
It shall be possible to start and stop the auxiliary machinery required to operate
the vessel from the steering station, unless they function automatically or
continuously during each voyage.
(ii) The critical levels of:
• The temperature of the water for cooling the main engines,
• The oil pressure of the main engines and transmission gear,
• The oil and air pressure of the devices for reversing the main engines, the
reversible transmission gear or the propellers, and
• The filling level of the engine room hold shall be indicated by devices
which set off sound and visual alarms in the wheelhouse. The sound alarms
may be contained in a single sound apparatus and can be stopped once the
breakdown has been noted. The visual alarms shall be extinguished only
when the relevant problems they indicate have been eliminated.
(iii) The fuel feed and the cooling of the main engines shall be automatic.
(iv) It shall be possible for one person to man the helm without special effort even
at the maximum authorized draught.
(v) It shall be possible to initiate the visual and sound signals prescribed by the
European Code for Inland Waterways (CEVNI) for vessels under way from the
steering station.
(vi) If direct communication between the steering station and the bow of the vessel,
the stern of the vessel, the crew accommodation and the engine room is not
possible, a sound link shall be provided. For the engine room, the sound link
may be replaced by visual and sound signals.
(vii) It shall be possible for a single crew member on his/her own to launch the
required ship’s boat with due dispatch.
(viii) A spotlight, which can be manipulated from the steering station, shall be
installed on board.
(ix) The effort required to manipulate cranks and similar pivoting devices for lifting
equipment shall not be more than 16 kg.
(x) The towing winches shall be power-driven.
(xi) The bilge pumps and the deck swabbing pumps shall be power-driven.
ECE/TRANS/SC.3/172/Rev.1
page 154

(xii) The main control devices and monitoring instruments shall be arranged
ergonomically.
(xiii) It shall be possible to control the equipment referred to in paragraph 6-1.1 from
the steering station.
(xiv) The vessel shall be equipped with a VHF radiotelephone for the ship-to-ship
and shipping information networks.
23-9.2 The conformity or non-conformity of the vessel with the requirements of 23-9.1
above, shall be certified by a certificate issued by the Administration.
This certificate shall be kept on board the vessel.
23-10 MINIMUM CREW FOR SELF-PROPELLED CARGO VESSELS AND
PUSHERS 16
The minimum crew for self-propelled cargo vessels and pushers comprises:

Length of the Number of crew members for operating mode

Crew members
vessel L in m
A1 A2 B
boatmaster 1 2 2
L ” 70 helmsman - - -
able crewman - - -
ordinary crewman 1 - 2

boatmaster 1 2 2
70 < L ” 86 helmsman - - -
able crewman 1 - -
ordinary crewman - 1 2

boatmaster 1 2 2
L > 86 helmsman 1 - 1
able crewman - - -
ordinary crewman 1 2 2 17


16
The competent authorities may permit different composition of a minimum crew in terms of categories of
posts, with the exception of a number of boatmasters which should not be below the level stipulated in this section.
Whatever is the composition of the minimum crew, its total number and qualifications should not be below the
levels stipulated in this section. Notwithstanding the above, on inland waterways, where national or international
legislation so allows, one or more of the ordinary crewmen may be replaced by apprentices or deckhands.
17
If the helmsman is replaced by a third boatmaster, one ordinary crewman shall be enough.
 ECE/TRANS/SC.3/172/Rev.1
page 155

23-11 MINIMUM CREW FOR PUSHED CONVOYS, SIDE-BY-SIDE

FORMATIONS AND OTHER RIGID FORMATIONS 18
23-11.1 The minimum crew for pushed convoys, side-by-side formations and other rigid
formations comprises:

Number of crew members for operating mode

Type of convoy Crew members
A1 A2 B

pusher + one pushed barge 19 Boatmaster 1 2 2

or formation with the helmsman 1 - 1
dimensions: able crewman - - -
L ” 116.5 m ordinary crewman 1 2 2 20
engineer or engine- - - -
B ” 15 m minder

pusher + two pushed barges Boatmaster 1 2 2

or helmsman 1 - 1
self-propelled vessel +one able crewman - - -
pushed barge ordinary crewman 2 3 2
engineer or engine- - - 1 21
minder

pusher + three or four pushed Boatmaster 1 2 2

barges or self-propelled vessel helmsman 1 - 1
+ two or three pushed barges able crewman - - -
22
ordinary crewman 2 3 3
engineer or engine- 1 1 1
minder

pusher + more than four Boatmaster 1 2 2

pushed barges helmsman 1 - 1
able crewman - - -
ordinary crewman 3 4 4 23
engineer or engine- 1 1 1
minder

23-11.2 The competent authority may prescribe different manning requirements for convoys
with a length of up to 82 m and a width of 11.45 m.

18
The competent authorities may permit different composition of a minimum crew in terms of categories of
posts, with the exception of a number of boatmasters which should not be below the level stipulated in this section.
Whatever is the composition of the minimum crew, its total number and qualifications should not be below the
levels stipulated in this section. Notwithstanding the above, on inland waterways, where national [or international]
legislation so allows, one or more of the ordinary crewmen may be replaced by apprentices or deckhands.
19
The term “pushed barge(s)” refers to a standard Europe II pushed barge or its equivalent in terms of length
(76.5m):
1 pushed barge = 2 pushed barges with a length > 25.50m and ≤ 38.25 m each (e.g. Likes barges);
1 pushed barge = 3 pushed barges with a length > 19.12m and ≤ 25.50 m each (e.g. Barko Liner barges);
1 pushed barge = 4 pushed barges with a length ≤ 19.12m each (e.g. Lash barges).
20
If the helmsman is replaced by a third boatmaster, one ordinary crewman shall be enough.
21
If the helmsman is replaced by a third boatmaster the crew may not need to include an engineer or an engine-
minder.
22
If the helmsman is replaced by a third boatmaster two ordinary crewmen shall be enough.
23
If the helmsman is replaced by a third boatmaster three ordinary crewmen shall be enough.
ECE/TRANS/SC.3/172/Rev.1
page 156

23-11.3 In the case of pushed barges or towed barges, one ordinary crewman is included for
every two pushed barges or towed barges.
23-12 MINIMUM CREW FOR PASSENGER VESSELS 24
23-12.1 The minimum crew for passenger vessels for day excursions comprises:

Maximum permitted Number of crew members for operating mode

Crew members
number of passengers
A1 A2 B
Boatmaster 1 2 2
helmsman - - -
up to 75 persons able crewman - - -
ordinary crewman 1 1 2
engineer or engine-minder - - -
Boatmaster 1 2 2
helmsman - - -
between 76 and 250
able crewman - - -
persons
ordinary crewman 2 25 1 2
engineer or engine-minder - 1 1
Boatmaster 1 2 3
helmsman - - -
between 251 and 600
able crewman 1 - -
persons
ordinary crewman - 1 1
engineer or engine-minder 1 1 1
Boatmaster 1 2 3
helmsman 1 - -
between 601 and 1 000
able crewman - - -
persons
ordinary crewman 2 2 2
engineer or engine-minder 1 1 1
Boatmaster 2 2 3
helmsman - - -
more than 1 000 persons able crewman - - -
ordinary crewman 3 4 4
engineer or engine-minder 1 1 1

23-12.2 The minimum crew for steamboats for day excursions should be increased by one
engineer in all operating modes.


24
The competent authorities may permit different composition of a minimum crew in terms of categories of
posts, with the exception of a number of boatmasters which should not be below the level stipulated in this section.
Whatever is the composition of the minimum crew, its total number and qualifications should not be below the
levels stipulated in this section. Notwithstanding the above, on inland waterways, where national or international
legislation so allows, one or more of the ordinary crewmen may be replaced by apprentices or deckhands.
25
Both ordinary crewmen may be replaced by one engineer or an engine-minder.
 ECE/TRANS/SC.3/172/Rev.1
page 157

23-12.3 The minimum crew for passenger cabin vessels comprises: 26

Group according to Number of crew members for operating mode

the number of Crew members
berths A1 A2 B

boatmaster 1 2 3
helmsman - - -
able crewman 1 - -
up to 50 berths
ordinary crewman - 1 1
engineer or 1 1 1
engine-minder
Boatmaster 1 2 3
helmsman 1 - -
between 51 and able crewman - - -
100 berths ordinary crewman 1 1 1
engineer or 1 1 1
engine-minder
Boatmaster 1 2 3
helmsman 1 - -
more than 100 able crewman - - -
berths ordinary crewman 2 3 3
engineer or 1 1 1
engine-minder

23-13 MANNING OF VESSELS WHOSE MINIMUM EQUIPMENT REFERRED

TO IN SECTION 23-9 IS INCOMPLETE
23-13.1 When the equipment of a self-propelled vessel, pusher, rigid convoy, or other rigid
assembly or passenger vessel does not correspond to the standard of equipment required in
paragraph 23-9.1, the minimum crew prescribed in sections 23-10, 23-11 or 23-12 shall be
increased by:
(i) One ordinary crewman in operating modes A1 and A2 and
(ii) Two ordinary crewmen in operating mode B. When, however, the
requirements of paragraph 23-9.1, letters (ix) and (x) only, or of one of these
letters are not met, the crew shall be increased in operating mode B by one
ordinary crewman instead of two.
23-13.2 In addition, when one or more of the requirements of paragraph 23-9.1, letters (i) to
(iii), are not met,
(i) The ordinary crewman prescribed in 23-13.1 (i) above shall be replaced by an
engine-minder in operating modes A1 and A2 and
(ii) The two ordinary crewmen prescribed in 23-13.1 (ii) above shall be replaced
by two engine-minders in operating mode B.

26
The competent authorities may permit different composition of a minimum crew in terms of categories of
posts, with the exception of a number of boatmasters which should not be below the level stipulated in this section.
Whatever is the composition of the minimum crew, its total number and qualifications should not be below the
levels stipulated in this section. Notwithstanding the above, on inland waterways, where national or international
legislation so allows, one or more of the ordinary crewmen may be replaced by apprentices or deckhands.
ECE/TRANS/SC.3/172/Rev.1
page 158

23-14 MINIMUM CREWS FOR OTHER VESSELS

The Administration shall determine for vessels not mentioned in sections 23-10 to
23-12 but covered by the present Recommendations in accordance with section 23-1 above
(e.g. tugs, towed barges, floating equipment, high-speed vessels), according to their dimensions,
form of construction, equipment and intended use, what crews shall be on board during
navigation.
CHAPTER 24
TRANSITIONAL AND FINAL PROVISIONS
(Left void)
 ECE/TRANS/SC.3/172/Rev.1
page 159
Appendix 1

APPENDIX 1
LIST OF EUROPEAN INLAND WATERWAYS
DIVIDED GEOGRAPHICALLY INTO ZONES 1, 2 AND 3
(paragraph 1-1.5 of the Recommendations)
CHAPTER I
ZONE 1
GERMANY
Ems, from a line linking the former Greetsiel lighthouse and the western pier of the port entrance
at Eemshaven as far as latitude 53°30'N and longitude 6°45'E, i.e. slightly seawards of the
lightering area for dry-cargo carriers in the Alte Ems. In the case of vessels whose home port is
elsewhere, account is to be taken of Article 32 of the Ems-Dollart Treaty of 8 April 1960 (BGBl.
1963 II, p. 602).

POLAND
Pomorska Bay, to the south of the line linking the headland of Nord Perd on the Rügen Island
and the Niechorze lighthouse.
Gdansk Bay, to the south of the line running from the Hel lighthouse to the entrance buoy to the
port of Baltijsk.

RUSSIAN FEDERATION
Vygozero.
Volqoqradskoe Reservoir, from Uvek bridge to the dam at the Volgograd hydroelectric power
station.
Votkinskoe Reservoir, from the Chastye wharf to the dam at the Votkinsk hydroelectric power
station.
Kamskoe Reservoir, from Berezniki to the dam at the Kama hydroelectric power station.
Kuybyshevskoe Reservoir, along the Volga river, from the town of Kamskoe Ustye to the dam at
the Kuybyshev hydroelectric power station; along the Kama river from Chistopol to Kamskoe
Ustye.
Rybinskoe Reservoir, with the exception of the northern section from Cherepovets to Vichelovo.
Tsimlyanskoe Reservoir, from Pyatiizbyan roadsteads to the dam at Tsimlyansk hydroelectric
power station.
Volgokaspijskiy Kanal, from buoy 217 (146.0 km) to the Astrakhan lighthouse.
Don, from Azov to the port of Taganrog.
Nizhne-Kamskoe Reservoir, from the town of Ust-Belsk (1,766 km) to the dam at the Lower
Kama hydroelectric power station;
Mezen, from the mouth of the Bolshaya Chetsa River to the Mezen entrance buoy.
ECE/TRANS/SC.3/172/Rev.1
page 160
Appendix 1

Pechora, from the Alekseevsky Island to the line between the Cape of Bolvansky Nos – northern
extremity of the Lovetsky Island.
Northern Dvina – along the Maymaksan branch from the village of Lapominka to the southern
extremity of the Mudiug Island, along the Murmansk branch to the Kumbysh Island.

UKRAINE
Dniprobuzkiy Lyman, up to the Port of Ochakiv.
Pivdenny Buh, downstream of Mykolaiv sea port.
Kakhovske reservoir, from the dam of Kakhovska Hydro-electric Plant to Bilenka wharf
(180 km).
Kremenchuzke Reservoir, from the dam of Kremenchuzka Hydro-electric Plant to the Topylivka
village (70 km).

UNITED KINGDOM OF GREAT BRITAIN AND NORTHERN IRELAND

1. Inland waterways of Scotland
Blue Mull Sound, between Gutcher and Belmont.
Yell Sound, between Tofts Voe and Ulsta.
Sullom Voe, within a line from the north-east point of Gluss Island to the northern point of
Calback Ness.
Dales Voe, in winter: within a line from the north point of Kebister Ness to the Coast of
Breiwick at longitude 1°10.8'W; in summer: as for Lerwick.
Lerwick, in winter: within the area bounded to the northward by a line from Scottle Holm to
Scarfi Taing on Bressay and to the southward by a line from Twageos Point Lighthouse to
Whalpa Taing on Bressay. In summer: within the area bounded to the northward by a line from
Brim Ness to the north east corner of Inner Score and to the southward by a line from the south
end of Ness of Sound to Kirkabisterness.
Kirkwall, between Kirkwall and Rousay not east of a line between Point of Graand (Egilsay) and
Galt Ness (Shapinsay) or between Head of Work (Mainland) through Helliar Holm light to the
shore of Shapinsay; not north west of the south east tip of Eynhallow Island, not to seaward and
a line between the shore on Rousay at 59°10.5N 002°57.1W and the shore on Egilsay at
59°10.0N 002°56.4W.
Stromness, to Scapa but not outside Scapa Flow.
Scapa Flow, within an area bounded by lines drawn from Point of Cletts on the island of Hoy to
Thomson's Hill triangulation point on the island of Fara and thence to Gibraltar Pier on the island
of Flotta; from St Vincent Pier on the island of Flotta to the westernmost point of Calf of Flotta;
from the easternmost point of the Calf of Flotta to Needle Point on the island of South Ronaldsay
and from the Ness on Mainland to Point of Oxan lighthouse on the island of Graemsay and
thence to Bu Point on the island of Hoy; and seaward of Zone 2 waters.
Balnakiel Bay, between Eilean Dubh and A'Chleit.
 ECE/TRANS/SC.3/172/Rev.1
page 161
Appendix 1

Cromarty Firth, within a line from North Sutor to Nairn Breakwater and seaward of Zone 2
waters.
Inverness, within a line from North Sutor to Nairn Breakwater and seaward of Zone 2 waters.
River Tay – Dundee, within a line from Broughty Castle to Tayport and seaward of Zone 2
waters.
Firth of Forth and River Forth, within a line from Kirkcaldy to River Portobello and seaward of
Zone 2 waters.
Solway Firth, within a line from Southerness Point to Silloth.
Loch Ryan, within a line from Finnart's Point to Milleur Point and seaward of Zone 2 waters.
The Clyde, Outer limit: a line from Skipness to a position one mile south of Garroch Head
thence to Farland Head; Inner limit in winter: a line from Cloch Lighthouse to Dunoon Pier;
Inner limit in summer: a line from Bogany Point, Isle of Bute to Skelmorlie Castle and a line
from Ardlamont Point to the southern extremity of Ettrick Bay inside the Kyles of Bute. Note:
The above inner summer limit is extended between 5 June and 5 September (both dates
inclusive) by a line from a point two miles off the Ayrshire coast at Skelmorlie Castle to Tomont
End, Cumbrae, and a line from Portachur Point, Cumbrae to Inner Brigurd Point, Ayrshire.
Oban, within an area bounded on the north by a line from Dunollie Point Light to Ard na
Chruidh and to the south by a line from Rudha Seanach to Ard na Cuile.
Kyle of Lochalsh, through Loch Alsh to the head of Loch Duich.
Loch Gairloch, in winter: none. In summer: South of a line running east from Rubha na Moine to
Eilan Horrisdale and thence to Rubha nan Eanntag.

2. Inland waterways of Northern Ireland

Belfast Lough, in winter: none. In summer: within a line from Carrickfergus to Bangor and
seaward of Zone 2 waters.
Loch Neagh, at a greater distance than 2 miles from the shore.

3. Inland waterways of East coast of England

River Humber, in winter: within a line from New Holland to Paull. In summer: within a line
from Cleethorpes Pier to Patrington Church and seaward of Zone 2 waters.

4. Inland waterways of Wales and West coast of England

River Severn, in winter: within a line from Blacknore Point to Caldicot Pill, Porstkewett. In
summer: within a line from Barry Dock Pier to Steepholm and thence to Brean Down and
seaward of Zone 2 waters.
River Wye, in winter: within a line from Blacknore Point to Caldicot Pill, Portskewett. In
summer: within a line from Barry Dock Pier to Steepholm and thence to Brean Down and
seaward of Zone 2 waters.
Newport, in winter: none. In summer: within a line from Barry Dock Pier to Steepholm and
thence to Brean Down and seaward of Zone 2 waters.
ECE/TRANS/SC.3/172/Rev.1
page 162
Appendix 1

Cardiff, in winter: none. In summer: within a line from Barry Dock Pier to Steepholm and thence
to Brean Down and seaward of Zone 2 waters.
Barry, in winter: None. In summer within a line from Barry Dock Pier to Steepholm and thence
to Brean Down and seaward of Zone 2 waters.
Swansea, within a line joining the seaward ends of the breakwaters.
Menai Straits, within the Menai Straits from a line joining Llanddwyn Island Light to Dinas
Dinlleu and lines joining the south end of Puffin Island to Trwyn DuPoint and Llanfairfechan
Railway Station, and seaward of Zone 2 waters.
River Dee, in winter: within a line from Hilbre Point to Point of Air. In summer: within a line
from Formby Point to Point of Air and seaward of Zone 2 waters.
River Mersey, in winter: None. In summer: within a line from Formby Point to Point of Air and
seaward of Zone 2 waters.
Preston and Southport, within a line from Southport to Blackpool inside the banks and seaward
of Zone 2 waters.
Fleetwood, in winter: None. In summer: within a line from Rossal Point to Humphrey Head and
seaward of Zone 2 waters.
River Lune, in winter: None. In summer: within a line from Rossal Point to Humphrey Head and
seaward of Zone 2 waters.
Heysham, in winter: None. In summer: within a line from Rossal Point to Humphrey Head.
Morecambe, in winter: None. In the summer: from within a line from Rossal Point to Humphrey
Head.
Workington, within a line from Southerness Point to Silloth and seaward of Zone 2 waters.

5. Inland waterways of South of England

River Colne, Colchester, in winter: within a line from Colne Point to Whitstable. In summer:
within a line from Clacton Pier to Reculvers.
River Blackwater, in winter: within a line from Colne Point to Whitstable. In summer: within a
line from Clacton Pier to Reculvers and seaward of Zone 2 waters.
River Crouch and River Roach, in winter: within a line from Colne Point to Whitstable. In
summer: within a line from Clacton Pier to Reculvers and seaward of Zone 2 waters.
River Thames and its tributaries, in winter: within a line from Colne Point to Whitstable. In
summer: within a line from Clacton Pier to Reculvers and seaward of Zone 2 waters.
River Medway and the Swale, in winter: within a line from Colne Point to Whitstable. In
summer: within a line from Clacton Pier to Reculvers and seaward of Zone 2 waters.
Chichester, inside the Isle of Wight within an area bounded by lines drawn between the church
spire, West Wittering, to Trinity Church, Bembridge, to the eastward, and the Needles and Hurst
Point to the westward and seaward of Zone 2 waters.
Langstone Harbour, inside the Isle of Wight within an area bounded by lines drawn between the
church spire, West Wittering, to Trinity Church, Bembridge, to the eastward, and the Needles
and Hurst Point to the westward and seaward of Zone 2 waters.
 ECE/TRANS/SC.3/172/Rev.1
page 163
Appendix 1

Portsmouth, inside the Isle of Wight within an area bounded by lines drawn between the church
spire, West Wittering, to Trinity Church, Bembridge, to the eastward, and the Needles and Hurst
Point to the westward and seaward of Zone 2 waters.
Bembridge, Isle of Wight, inside the Isle of Wight within an area bounded by lines drawn
between the church spire, West Wittering, to Trinity Church, Bembridge, to the eastward, and
the Needles and Hurst Point to the westward and seaward of Zone 2 waters.
Cowes, Isle of Wight, inside the Isle of Wight within an area bounded by lines drawn between
the church spire, West Wittering, to Trinity Church, Bembridge, to the eastward, and the Needles
and Hurst Point to the westward and seaward of Zone 2 waters.
Southampton, inside the Isle of Wight within an area bounded by lines drawn between the
church spire, West Wittering, to Trinity Church, Bembridge, to the eastward, and the Needles
and Hurst Point to the westward and seaward of Zone 2 waters.
Beaulieu River, inside the Isle of Wight within an area bounded by lines drawn between the
church spire, West Wittering, to Trinity Church, Bembridge, to the eastward, and the Needles
and Hurst Point to the westward and seaward of Zone 2 waters.
Keyhaven Lake, inside the Isle of Wight within an area bounded by lines drawn between the
church spire, West Wittering, to Trinity Church, Bembridge, to the eastward, and the Needles
and Hurst Point to the westward and seaward of Zone 2 waters.
Weymouth, within Portland Harbour and between the River Wey and Portland Harbour.
Plymouth, within a line from Cawsand to Breakwater to Staddon and seaward of Zone 2 waters.
Falmouth, in winter: within a line from St. Anthony Head to Rosemullion. In summer: within a
line from St. Anthony Head to Nare Point and seaward of Zone 2 waters.
River Camel, within a line from Stepper Point to Trebetherick Point and seaward of Zone 2
waters.
Bridgewater, within the bar and seaward of Zone 2 waters.
River Avon (Avon), in winter: within a line from Blacknore Point to Caldicot Pill, Portskewett.
In summer: within a line from Barry Pier to Steepholm and thence to Brean Down and seaward
of Zone 2 waters.
CHAPTER II
ZONE 2
CZECH REPUBLIC
Dam Lake Lipno.

FRANCE
Dordogne, downstream from the stone bridge at Libourne.
Garonne, downstream from the stone bridge at Bordeaux.
Gironde, downstream from the stone bridge at Bordeaux.
Loire, downstream from Haudaudine bridge on the Madeleine branch and downstream from
Pirmil bridge on the Pirmil branch.
ECE/TRANS/SC.3/172/Rev.1
page 164
Appendix 1

Rhône, downstream from Trinquetaille bridge at Arles and beyond towards Marseilles.
Seine, downstream from Jeanne-d'Arc bridge at Rouen.

GERMANY
Ems, from a line across the river Ems near the entrance to Papenburg harbour between Diemen
pumping station and the opening of the dyke at Halte as far as a line linking the former Greetsiel
lighthouse and the western pier of the port entrance at Eemshaven.
Jade, inside a line linking the Schillighörn cross light and Langwarden church tower.
Weser, from the north-western edge of the Bremen railway bridge as far as a line linking
Langwarden and Cappel church towers with the side branches: Westergate, Rekumer Loch,
Rechter Nebenarm and Schweiburg.
Elbe, from the lower limit of the port of Hamburg to a line linking the Döse beacon and the
north-western point of the Friedrichskoog dyke (Dieksand) with the Nebenelben as well as the
tributaries: Este, Lühe, Schwinge, Oste, Pinnau, Krückau and Stör (in each case from the barrage
to the mouth).
Meldorfer Bucht, inside a line linking the western edge of Friedrichskoog dyke (Dieksand) and
Büsum west pier head.
Eider, from the Gieselau Canal to the Eider barrage.
Flensburger Förde, inside a line linking Kegnäs lighthouse and Birknack.
Schlei, inside a line linking the Schleimünde pier heads.
Eckernförder Bucht, inside a line linking Boknis-Eck to the north-eastern point of the mainland
near Dänisch Nienhof.
Kieler Förde, inside a line linking Bülk lighthouse at the Laboe naval memorial.
Nord-Ostsee-Kanal (Kiel Canal), from the line linking the Brunsbüttel pier heads to a line
linking the entrance lights of Kiel-Holtenau including Obereidersee with Enge, Audorfer See,
Bergstedter See, Schirnauer See, Flemhuder See and Achterwehrer Schiffahrtskanal.
Trave, from the north-western edge of the railway lift bridge and the northern adge of the
Holsten Bridge (Stadttrave) in Lübeck to a line linking the two outer pier heads at Travemünde
including the Pötenitzer Wiek, Dassower See and the Altarmen at Teerhof island.
Leda, from the entrance to the outer harbour of the Leer sea lock to the mouth.
Hunte, from Oldenburg harbour and from 140 m downstream of the Amalienbrücke in
Oldenburg to the mouth.
Lesum, from the Bremen-Burg railway bridge to the mouth.
Este, from the tail water of Buxtehude lock to the Este barrage.
Lühe, from the tail water of the Au-Mühle in Horneburg to the Lühe barrage.
Schwinge, from the Salztor lock in Stade to the Schwinge barrage.
Freiburger Hafenpriel, from the eastern edge of the sluice in Freiburg/Elbe as far as the mouth.
Oste, from the north-eastern edge of the Bremervörde mill dam to the Oste barrage.
 ECE/TRANS/SC.3/172/Rev.1
page 165
Appendix 1

Pinnau, from the south-western edge of the Pinneberg railway bridge to the Pinnau barrage.
Krückau, from the south-western edge of the bridge leading to/from the Wedenkamp in
Elmshorn to the Krückau barrage.
Stör, from the Rensing tide gauge to the Stör barrage.
Wismarbucht, Kirchsee, Breitling, Salzhaff and Wismar port area, limited seawards by a line:
Hohen Wieschendorf Huk and Timmendorf light as well as Gollwitz light on the Island of Poel
and the southern point of Wustrow Peninsula.
Warnow, including Breitling and side branches, downstream of the Mühlendamm from the
northern edge of the Geinitzbrücke in Rostock towards the sea as far as a line linking the
northern points of the western and eastern piers in Warnemünde.
Waters between the mainland and the Darss and Zingst peninsulas as well as the Hiddensee and
Rügen islands (including Stralsund port area), limited seawards between:
• the Zingst peninsula and the island of Bock by the parallel of latitude 54°26'42’’ N;
• the islands of Bock and Hiddensee by a line linking the northern point of the island of
Bock and the southern point of the island of Hiddensee;
• the island of Hiddensee and the island of Rügen (Bug) by a line linking the south-
eastern point of Neubessin to Buger Haken.
Greifswalder Bodden and Greifswald port area including the river Ryck, limited seawards by a
line linking the eastern point Thiessower Haken (Südperd) to the eastern point of the island of
Ruden and further to the northern point of the island of Usedom (54° 10'37'' N, 13°47'51'' E).
Waters between the mainland and the island of Usedom (Peenestrom including Wolgast port
area, Achterwasser, Stettiner Haff), limited in the east by the border between the Federal
Republic of Germany and the Republic of Poland in the Stettiner Haff.

HUNGARY
Lake Balaton

LITHUANIA
Curonian Lagoon, from the mouth of river Atmata to Klaipeda.

NETHERLANDS
Dollard.
Eems.
Waddenzee, including the links with the North Sea.
IJsselmeer, including the Markermeer and the IJmeer but excluding the Gouwzee.
Nieuwe Waterweg and Scheur.
Hollands Diep.
Harringvliet and Vuile Gat, including the waterways between Goeree-Overflakkee on the one
hand and Voorne-Putten and Hoekse Waard on the other.
ECE/TRANS/SC.3/172/Rev.1
page 166
Appendix 1

Hellegat.
Volkerak.
Krammer.
Grevelingenmeer and Brouwershavense Gat, including all the waterways between Schouwen-
Duiveland and Goeree-Overflakkee.
Keten, Mastgat, Krabbenkreek, Zijpe Eastern Scheldt and Roompot, including the waterways
between Walcheren, Noord-Beveland and Zuid-Beveland on the one hand and Schouwen-
Duiveland and Tholen on the other hand, excluding the Scheldt-Rhine Canal.
Scheldt and Western Scheldt and its mouth on the sea, including the waterways between Zeeland
Flanders on the one hand and Walcheren and Zuid-Beveland on the other, excluding the Scheldt-
Rhine Canal.
Breediep, Beerkanaal and its connected harbours.
Kanaal west from the Benelux harbour.

POLAND
Lagoon of Szczecin.
Lagoon of KamieĔ.
Lagoon of Wisła.
Bay of Puck.
Włocławski Reservoir.
Lake ĝniardwy.
Lake Niegocin.
Lake Mamry.

REPUBLIC OF MOLDOVA
Dubossarskoe Reservoir.
Koshteshtskoe Reservoir.

RUSSIAN FEDERATION
Beloe Lake.
Gorkovskoe Reservoir.
Ivankovskoe Reservoir.
Rybinskoe Reservoir, from Cherepovets to Vichelovo.
Saratovskoe Reservoir, from Syzran bridge to the dam at the Saratov hydroelectric power station.
Uglicheskoe Reservoir.
Sheksninskoe Reservoir.
Don, from Rostov-na-Donu to Azov.
 ECE/TRANS/SC.3/172/Rev.1
page 167
Appendix 1

Svir.
Volgo-Donskoj Kanal, from Volgograd to Pyatiizbyanskije roadsteads.
Kanal im. Moskvi, from the Bolshaya Volga wharf to lock No. 7.
Volgo-Kaspijskiy Kanal, from the town of Krasnye Barrikady (0.0 km) to buoy 217 (146.0 km).
Chudskoye Lake.
Ilmen Lake.
Kubenskoye Lake.
Pskovskoye Lake.
Veselovskoe Reservoir.
Krasnodarskoe Reservoir.
Cheboksarskoe Reservoir.
Belaya – from Yamalinsky Yar (1,786 km) to the mouth.
Volga – from the city of Tver to the town of Koprino (including Ivankovskoe and Uglichskoe
reservoirs), from the dam at the Rybinsk hydro-electric power station to the Elyat mouth, from
the dam at the Gorkovskaya hydro-electric power station to the Sura mouth, from the dam at the
Cheboksary hydro-electric power station to the village of Kamskoe Ustye, from the dam at the
Kuibyshevskaya hydro-electric power station to Syzran bridge, from the dam at the Saratov
hydro-electric power station to Uvek bridge, from the dam at the Volgograd hydro-electric
power station to the town of Krasnye Barrikady.
Kama – from the dam at the Kama hydro-electric power station to the Chastye wharf, from the
dam at the Votkinsk hydro-electric power station to the town of Ust-Belsk (1,766 km), from the
dam at the Lower Kama hydro-electric power station to Tchistopol.
Mezen – from the city of Mezen to the Bolshaya Chetsa mouth.
Neva – from the source to the border of the inland waterways: along the Bolshaya Neva –
Lieutenant Schmidt bridge; along the Malaya Neva – the alignment of the 1st Line of the
Vasilyev island; along the Bolshaya Nevka – the alignment of spit of the Elagin island; along the
Srednaya Nevka – the upper cape of the mouth of the Chukhonka river (the entrance to the
rowing canal); along the Malaya Nevka – Petrovsky bridge.
Northern Dvina – from the Pinega mouth to the Uyma mouth; along the Maymaksan branch
from the Uyma mouth to the village of Lapominka; along the Nikolskiy branch and channels
between the isles of Yagra, Uglomin and Nikolsky to south-west extremity of the isle of Yagra.
White Sea access canal to the entrance buoy.
Gulfs of Veslinsk and Kaliningrad including the sea port of Kaliningrad and the canal to the line
between the ends of the south and north moles of the port of Baltiysk.
Volga-Baltic Canal – from the Onega Lake to the dam at the Sheksna hydroelectric power station
including the Sizmin flooding.
Gulf of Kurshsky to the line between the ends of the south and north moles of the entrance gate
to the port of Klaipeda.
ECE/TRANS/SC.3/172/Rev.1
page 168
Appendix 1

Nevskaya Guba – from the border of inland waterways to the dam along the line between
Gorskaya – Kronshtadt – Oranienbaum;
Petchora, from the village of Ust-Tzilma to the city of Naryan-Mar.

UKRAINE
Dnipro, downstream of the Port of Kyiv (with the exception of areas belonging to zone 1) and
the section from the wharf Teremtsy to the dam of Kyiv Hydro-electric Plant.
Pripyat, downstream of Vydoumka wharf.
Pivdenny Buh, from Ternovate village to Mykolaiv sea port.
Dnistrovskiy Lyman.
Dnistrovske Reservoir, from the dam to Dnistrovka village (60 km).
Kakhovske Reservoir, upstream of the Bilenka wharf (180 km).
Dniprovske Reservoir.
Kremenchuzke Reservoir, upstream of Topylivka village (70 km).
Dniprodzerzhynske Reservoir.
Kanivske Reservoir, from the dam of Kanivska Hydro-electric Plant to Novo-Ukrainka wharf.
Kyivske Reservoir, from the dam of Kyivska Hydro-electric Plant to Teremtsy wharf on the
Dnipro and to Vydumka wharf on the Pripyat.
Pechenezke Reservoir.
Krasnooskolske Reservoir.
Burshtynske Reservoir.
Svitiaz Lake.

UNITED KINGDOM OF GREAT BRITAIN AND NORTHERN IRELAND

1. Inland waterways of Scotland
Scapa Flow, within an area bounded by lines drawn from Wharth on the island of Flotta to the
Martello Tower on South Walls, and from Point Cletts on the island of Hoy to Thomson's Hill
triangulation point on the island of Fara and thence to Gibraltar Pier on the island of Flotta.
Kyle of Durness, south of Eilean Dubh.
Cromarty Firth, within a line between North Sutor and South Sutor.
Inverness, within a line from Fort George to Chanonry Point.
Findhorn Bay, within the spit.
Aberdeen, within a line from South Jetty to Abercromby Jetty.
Montrose Basin, to the west of a line running north-south across the harbour entrance at Scurdie
Ness Lighthouse.
River Tay – Dundee, within a line from the tidal basin (fish dock), Dundee to Craig Head, East
Newport.
 ECE/TRANS/SC.3/172/Rev.1
page 169
Appendix 1

Firth of Forth and River Forth, within the Firth of Forth but not east of the Forth railway bridge.
Dumfries, within a line from Airds Point to Scar Point.
Loch Ryan, within a line from Cairn Point to Kircolm Point.
Ayr Harbour, inside the Bar.
The Clyde, above Zone 1 waters.
Kyles of Bute, between Colintraive and Rhubodach.
Campbeltown Harbour, within a line from Macringan's Point to Ottercharach Point.
Loch Etive, within Loch Etive above the Falls of Lora.
Loch Leven, above the bridge at Ballachulish.
Loch Linnhe, North of Corran Point light.
Loch Eil, the whole loch.
Caledonian Canal, Lochs Lochy, Oich and Ness.
Kyle of Lochalsh, within Kyle Akin not westward of Eilean Ban Light or eastward of Eileanan
Dubha.
Loch Carron, between Stromemore and Strome Ferry.
Loch Broom, Ullapool, within a line from Ullapool Point Light to Aultnaharrie.
Kylesku, across Loch Cairnbawn in the area between the easternmost point of Garbh Eilean and
the westernmost point of Eilean na Rainich.
Stornoway Harbour, within a line from Arnish Point to Sandwick Bay Lighthouse, north-west
side.
The Sound of Scalpay, not east of Berry Cove (Scalpay) and not west of Croc a Loin (Harris).
North Harbour, Scalpay and Tarbert Harbour, within one mile from the shore of the Island of
Harris.
Loch Awe, the whole loch.
Loch Katrine, the whole loch
Loch Lomond, the whole loch.
Loch Tay, the whole loch
Loch Loyal, the whole loch.
Loch Hope, the whole loch.
Loch Shin, the whole loch.
Loch Assynt, the whole loch.
Loch Glascarnoch, the whole loch.
Loch Fannich, the whole loch.
Loch Maree, the whole loch.
ECE/TRANS/SC.3/172/Rev.1
page 170
Appendix 1

Loch Gairloch, the whole loch.

Loch Monar, the whole loch.
Loch Mullardach, the whole loch.
Loch Cluanie, the whole loch.
Loch Loyne, the whole loch.
Loch Garry, the whole loch.
Loch Quoich, the whole loch.
Loch Arkaig, the whole loch.
Loch Morar, the whole loch.
Loch Shiel, the whole loch.
Loch Earn, the whole loch.
Loch Rannoch, the whole loch.
Loch Tummel, the whole loch.
Loch Ericht, the whole loch.
Loch Fionn, the whole loch.
Loch Glass, the whole loch.
Loch Rimsdale/nan Clar, the whole loch.

2. Inland waterways of Northern Ireland

Strangford Lough, within a line from Cloghy Point to Dogtail Point.
Belfast Lough, within a line from Holywood to Macedon Point.
Larne, within a line from Larne Pier to the ferry pier on Island Magee.
River Bann, from the seaward ends of the breakwaters to Toome Bridge.
Lough Erne, upper and Lower Lough Erne.
Lough Neagh, within two miles of the shore.

3. Inland waterways of East Coast of England

Berwick, within the breakwaters.
Warkworth, within the breakwaters.
Blyth, within the Outer Pier Heads.
River Tyne, Dunston Staithes to Tyne Pier Heads.
River Wear, Fatfield to Sunderland Pier Heads.
Seaham, within the breakwaters.
Hartlepool, within a line from Middleton Jetty to Old Pier Head. Within a line joining North Pier
Head to South Pier Head.
 ECE/TRANS/SC.3/172/Rev.1
page 171
Appendix 1

River Tees, within a line extending due west from Government Jetty to Tees Barrage.
Whitby, within Whitby Pier Heads.
River Humber, within a line from North Ferriby to South Ferriby.
Grimsby Dock, within a line from the West Pier of the Tidal Basin to the East Pier of the Fish
Docks, North Quay.
Boston, inside the New Cut.
Dutch River, the whole Canal.
River Hull, Beverley Beck to River Humber.
Kielder Water, the whole Lake.
River Ouse, below Naburn Lock.
River Trent, below Cromwell Lock.
River Wharfe, from the junction with River Ouse to Tadcaster Bridge.
Scarborough, within Scarborough Pier Heads.

4. Inland waterways of Wales and West coast of England

River Severn, north of a line running due west from Sharpness Point (51° 43.4'N) to Llanthony
and Maisemore Weirs and seaward of Zone 3 waters.
River Wye, at Chepstow, north of latitude (51° 38.0'N) to Monmouth.
Newport, north of the overhead power cables crossing at Fifoots Points.
Cardiff, within a line from South Jetty to Penarth Head and the enclosed waters to the west of
Cardiff Bay Barrage.
Barry, within a line joining the seaward ends of the breakwaters.
Port Talbot, within a line joining the seaward ends of the breakwaters on the River Afran outside
enclosed docks.
Neath, within a line running due North from the seaward end of Baglan Bay Tanker Jetty
(51°37.2'N, 3°50.5'W).
Llanelli and Burry Port, within an area bounded by a line drawn from Burry Port Western Pier to
Whiteford Point.
Milford Haven, within a line from South Hook Point to Thorn Point.
Fishguard, within a line joining the seaward ends of the north and east breakwaters.
Cardigan, within the Narrows at Pen-Yr-Ergyd.
Aberystwyth, within the seaward ends of the breakwaters.
Aberdyfi, within a line from Aberdyfi Railway Station to Twyni Bach Beacon.
Barmouth, within a line from Barmouth Railway Station to Penrhyn Point.
Portmadoc, within a line from Harlech Point to Graig Ddu.
ECE/TRANS/SC.3/172/Rev.1
page 172
Appendix 1

Holyhead, within an area bounded by the main breakwater and a line drawn from the head of the
breakwater to Brynglas Point, Towyn Bay.
Menai Straits, within the Menai Straits between a line joining Aber Menai Point to Belan Point
and a line joining Beaumaris Pier to Pen-y-Coed Point.
Conway, within a line from Mussel Hill to Tremlyd Point.
Llandudno, within the breakwater.
Rhyl, within the breakwater.
River Dee, above Connah's Quay to Barrelwell Hill water extraction point.
River Mersey, within a line between the Rock Lighthouse and the North West Seaforth Dock but
excluding other docks.
Preston and Southport, within a line from Lytham to Southport and within Preston Docks.
Fleetwood, within a line from Low Light to Knott.
River Lune, within a line from Sunderland Point to Chapel Hill up to and including Glasson
Dock.
Barrow, within a line joining Haws Point, Isle of Walney to Roa Island Slipway.
Whitehaven, within the breakwater.
Workington, within the breakwater.
Maryport, within the breakwater.
Carlisle, within a line joining Point Carlisle to Torduff.
Coniston Water, the whole Lake.
Derwentwater, the whole Lake.
Ullswater, the whole Lake.
Windermere, the whole Lake.

5. Inland waterways of South of England

Blakeney and Morston Harbour and approaches, to the east of a line running south from
Blakeney Point to the entrance of the Stiffkey River.
River Orwell and River Stour, river Orwell within a line from Blackmanshead breakwater to
Landguard Point and seaward of Zone 3 waters.
River Blackwater, all waterways within a line from the south-western extremity of Mersea Island
to Sales Point.
River Crouch and River Roach, river Crouch within a line from Holliwell Point to Foulness
Point, including the River Roach.
River Thames and its Tributaries, river Thames above a line drawn north/south through the
eastern extremity of Denton Wharf Pier, Gravesend to Teddington Lock.
River Medway and the Swale, river Medway from a line drawn from Garrison Point to the Grain
Tower, to Allington Lock; and the Swale from Whitstable to the Medway.
 ECE/TRANS/SC.3/172/Rev.1
page 173
Appendix 1

River Stour (Kent), river Stour above the mouth to the landing at Flagstaff Reach.
Dover Harbour, within lines drawn across the east and west entrances to the Harbour.
River Rother, river Rother above the Tidal Signal Station at Camber to Scots Float Sluice and to
the entrance lock on the River Brede.
River Adur and Southwick Canal, within a line drawn across Shoreham Harbour entrance to
Southwick Canal Lock and to the west end of Tarmac Wharf.
River Arun, river Arun above Littlehampton Pier to Littlehampton Marina.
River Ouse (Sussex) Newhaven, river Ouse from a line drawn across Newhaven Harbour
entrance piers to the north end of North Quay.
Brighton, Brighton Marina outer harbour within a line from the southern end of West Quay to
the north end of South Quay.
Chichester, within a line drawn between Eastoke point and the church spire, West Wittering and
seaward of Zone 3 waters.
Langstone Harbour, within a line drawn between Eastney Point and Gunner Point.
Portsmouth, within a line drawn across the harbour entrance from Port Blockhouse to the Round
Tower.
Bembridge, Isle of Wight, within Brading Harbour.
Cowes, Isle of Wight, the River Medina within a line from the Breakwater Light on the east bank
to the House Light on the west bank.
Southampton, within a line from Calshot Castle to Hook Beacon.
Beaulieu River, within Beaulieu River not eastward of a north/south line through Inchmery
House.
Keyhaven Lake, within a line drawn due north from Hurst Point Low Light to Keyhaven
Marshes.
Christchurch, the Run.
Poole, within the line of the Chain Ferry between Sandbanks and South Haven Point.
Exeter, within an east-west line from Warren Point to the Inshore Lifeboat Station opposite
Checkstone Ledge.
Teignmouth, within the harbour.
River Dart, within a line from Kettle Point to Battery Point.
River Salcombe, within a line from Splat Point to Limebury Point.
Plymouth, within a line from Mount Batten Pier to Raveness Point through Drake's Islands; the
River Yealm within a line from Warren Point to Misery Point.
Fowey, inside the Harbour.
Falmouth, within a line from St. Anthony Head to Pendennis Point.
River Camel, within a line from Gun Point to Brea Hill.
ECE/TRANS/SC.3/172/Rev.1
page 174
Appendix 1

Rivers Taw and Torridge, within a line bearing 200° from the lighthouse on Crow Point to the
shore at Skern Point.
Bridgewater, south of a line running due East from Stert Point (51° 13.0'N).
River Avon (Avon), within a line from Avonmouth Pier to Wharf Point, to Netham Dam.

CHAPTER III
ZONE 3
AUSTRIA
Danube, from the border with Germany to the border with Slovakia.
Inn, from the mouth to the Passau-Ingling Power Station.
Traun, from the mouth to km 1,80.
Enn, from the mouth to km 2,70.
March, to km 6,00.

BELARUS
Dnepr, from the mouth of the Leshch river to the Lyubech wharf.
Neman, from Mosta to the frontier with Lithuania.
Pripyat, from the Stakhovo lock to the frontier with the Ukraine.
Zapadnaja Dvina, from the mouth of the Usvyacha river to V. Dvinsk.
Sozh, from Grodno to the mouth.
Berezina, from Borisov to the mouth.
Dneprovsko-Bugskiy Kanal, from Brest to the Stakhovo lock.
Mikashevicheskiy Kanal, from Mikashevichi to the Pripyat river.

BELGIUM
Maritime Scheldt, downstream of Antwerp open anchorage.

BULGARIA
Danube, from km 845.650 to km 374.100.

CROATIA
Danube.
Darva, from km 0,00 to km 70.
Sava, from km 207 to km 586.

CZECH REPUBLIC
Labe, from the lock Ústí nad Labem-StĜekov to the lock Lovosice.
 ECE/TRANS/SC.3/172/Rev.1
page 175
Appendix 1

Dam Lakes: Baška, BrnČnská (Kníniþky), Horka (Stráž pod Ralskem), Hracholusky, Jesenice,
Nechranice, Olešná, Orlík, Pastviny, Plumov, Rozkoš, Seþ, Skalka, Slapy, TČrlicko, Žermanice.
Lake Máchovo.
Water Area Velké Žernoseky.
Ponds: Oleksovice, SvČt, Velké DáĜko.
Mining Gravel Lakes: Dolní Benešov, Ostrožná Nová Ves a Tovaþov.

FRANCE
Rhine.

GERMANY
Danube, from Kelheim (2,414.72 km) to the German/Austrian border.
Rhine, from the German/Swiss border to the German/Netherlands border.
Elbe, from the mouth of the Elbe-Seitenkanal to the lower limit of the port of Hamburg.
Müritz.

HUNGARY
Danube, from km 1,812 to km 1,433.
Danube Moson, from km 14 to km 0.
Danube Szentendre, from km 32 to km 0.
Danube Ráckeve, from km 58 to km 0.
River Tisza, from km 685 to km 160.
River Dráva, from km 198 to km 70.
River Bodrog, from km 51 to km 0.
River KettĘs-Körös, from km 23 to km 0.
River Hármas-Körös, from km 91 to km 0.
Channel Sió, from km 23 to km 0.
Lake Velence.
Lake FertĘ.

LITHUANIA
River Nemunas (Neman), from Kaunas to the mouth.

NETHERLANDS
Rhine.
Sneekermeer.
Koevordermeer.
ECE/TRANS/SC.3/172/Rev.1
page 176
Appendix 1

Heegermeer.
Fluessen.
Slotermeer.
Tjeukemeer.
Beulakkerwijde.
Belterwijde.
Ramsdiep.
Ketelmeer.
Zwartemeer.
Veluwemeer.
Eemmeer.
Alkmaardermeer.
Gouwzee.
Buiten IJ.
Afgesloten IJ.
Noordzeekanaal.
Port of IJmuiden.
Rotterdam port area.
Nieuwe Maas.
Noord.
Oude Maas.
Beneden Merwede.
Nieuwe Merwede.
Dordtsche Kil.
Boven Merwede.
Waal.
Bijlandsch Canal.
Boven Rijn.
Pannersdensch Canal.
Geldersche IJssel.
Neder Rijn.
Lek.
Amsterdam-Rhine Canal.
 ECE/TRANS/SC.3/172/Rev.1
page 177
Appendix 1

Veerse Meer.
Scheldt-Rhine Canal as far as the mouth in the Volkerak.
Amer.
Bergsche Maas.
Meuse, downstream from Venlo.
Gooimeer.
Europoort.
Caland Canal, east of Benelux Port.
Hartel Canal.

POLAND
River Biebrza, from the estuary of the Augustowski Canal to the estuary of the river Narwia.
River Brda, from the link with the Bydgoski Canal in Bydgoszcz to the estuary of the river
Wisła.
River Bug, from the estuary of the river Muchawiec to the estuary of the river Narwia.
Lake Dąbie, to the frontier with internal sea waters.
The Augustowski Canal, from the link with the river Biebrza to the State border, together with
the lakes located along the route of this Canal.
The Bartnicki Canal, from Lake Ruda Woda to Lake BartĊĪek, together with Lake BartĊĪek.
The Bydgoski Canal.
The Elbląski Canal, from Lake Druzno to Lake Jeziorak and Lake Szeląg Wielki, together with
these lakes and the lakes on the route of the Canal, and a byway in the direction of Zalewo from
Lake Jeziorak to Lake Ewingi, inclusive.
The Gliwicki Canal, together with the Canal KĊdzierzyĔski.
The JagielloĔski Canal, from the link with the river Elbląg to the river Nogat.
The ŁączaĔski Canal.
The ĝlesiĔski Canal, with the lakes located along the route of this Canal and Lake Gopło.
The ĩeraĔski Canal.
River Martwa Wisła, from the river Wisła in Przegalina to the frontier with internal sea waters.
River Narew, from the estuary of the river Biebrza to the estuary of the river Wisła, together with
Lake ZegrzyĔski.
River Nogat, from the river Wisła to the estuary of the Lagoon of Wisła.
River Noteü (upper), from Lake Gopło to the link with the Górnonotecki Canal and the
Górnonotecki Canal, and
River Noteü (lower), from the link of the Bydgoski Canal to the estuary to River Warta.
River Nysa ŁuĪycka, from Gubin to the estuary to River Odra.
ECE/TRANS/SC.3/172/Rev.1
page 178
Appendix 1

River Odra, from the town of Racibórz to the link with River Eastern Odra which turns into
River Regalica from the Klucz-Ustowo Piercing, together with that river and its side-branches to
Lake Dąbie as well as a byway of River Odra from the Opatowice lock to the lock in Wrocław
city.
River Western Odra, from a weir in Widuchowa (704.1 km of River Odra) to a border with
internal sea waters, together with side-branches as well as the Klucz-Ustowo Piercing linking
River Eastern Odra with River Western Odra.
River Parnica and the Parnicki Piercing, from River Western Odra to a border with internal sea
waters.
River Pisa, from Lake RoĞ to the estuary of River Narew.
River Szkarpawa, from River Wisła to the estuary of the Lagoon of Wisła.
River Warta, from the ĝlesiĔskie Lake to the estuary of River Odra.
System of Wielkie Jeziora Mazurskie, encompassing the lakes linked by the rivers and canals
constituting a main route from Lake RoĞ (inclusive) in Pisz to the WĊgorzewski Canal (including
that Canal) in WĊgorzewo, together with Lakes Seksty, Mikołajskie, Tałty, Tałtowisko, Kotek,
Szymon, Szymoneckie, Jagodne, Boczne, Tajty, Kisajno, Dargin, Łabap, Kirsajty and ĝwiĊcajty,
together with the GiĪycki Canal and the NiegociĔski Canal and the PiĊkna Góra Canal, and a
byway of Lake RyĔskie (inclusive) in Ryn to Lake Nidzkie (up to 3 km, constituting a border
with the ‘Lake Nidzkie’ nature reserve), together with lakes Bełdany, Guzianka Mała and
Guzianka Wielka.
River Wisła, from the estuary of River Przemsza to the link with the ŁączaĔski Canal as well as
from the estuary of that Canal in Skawina to the estuary of River Wisła to the Bay of GdaĔsk,
excluding the Włocławski Reservoir.

REPUBLIC OF MOLDOVA
Dnestr.
Prut, from the Koshteshtskaia hydroelectric power station to the mouth.

ROMANIA
Danube: from the Serbian – Romanian border (km 1,075) to the Black Sea via the Sulina branch.
Danube – Black Sea Canal (64.41 km length), from the junction with the Danube river, at km
299.3 of the Danube at Cernavodă (respectively km 64.41 of the Canal), to the Port of Constanta
South – Agigea (km “0” of the Canal).
Poarta Albă – Midia Năvodari Canal (27.5 km length), from the junction with the Danube –
Black Sea Canal at km 29.41 at Poarta Albă (respectively km 27.5 of the Canal) to the Port of
Midia (km “0” of the Canal).

RUSSIAN FEDERATION
Belomorsko-Baltijskiy Kanal.
Severnaja Dvina, from its uppermost navigable point to the mouth of the Pinega River.
Pechora, from its uppermost navigable point to Oust-Tsylma.
 ECE/TRANS/SC.3/172/Rev.1
page 179
Appendix 1

Volga, from its uppermost navigable point to Tver.

Kama , from the upper reaches to the city of Berezniki.
Manych, from the dam at Veselovsk reservoir to the mouth.
Mezen, from the upper reaches to the city of Mezen.
Oka (tributary of the Volga), from the upper reaches to the mouth.
Belaya, from the upper reaches to Yamalinsky Yar (1,786 km).
Don, from the upper reaches to Piatiizbiansk roadsteads and from the dam at the Tsymliansk
hydroelectric power station to Rostov-on-Don.
Voronezhskoe Reservoir.
Lakes, rivers and canals other than those mentioned in this appendix.

SERBIA
Danube, from the border with Hungary to the border with Bulgaria (km 1,433 to km 845.5).
Sava, from the border with Croatia to the mouth (km 207 to km 0).
Tisa, from the border with Hungary to the mouth (km 164 to km 0).

SLOVAKIA
Danube, from Devín (km 1,880.26) to the Slovak-Hungarian border.

SWITZERLAND
Rhine, from Rheinsfelden to Niffer (Kembs).

UKRAINE
Dnipro, upstream of Teremtsy wharf and the section from the Port of Kyiv to the dam of Kyiv
Hydro-electric Plant and the Stariy Dnipro Arm (beyond the Khortytsa Lake).
Pripyat, from the mouth to the Belarus/Ukraine frontier.
Desna and other tributaries of the Dnipro.
Pivdenny Buh, upstream of Ternovate village.
Dnister, upstream of Dnistrovka village.
Danube.
Ladyzhynske Reservoir.
Dnistrovske Reservoir, from Dnistrovka village (60 km from the dam) to Vylkhovtsy village
(190 km from the dam).
Other inland waterways not mentioned as belonging to zones 1 and 2.
ECE/TRANS/SC.3/172/Rev.1
page 180
Appendix 1

UNITED KINGDOM OF GREAT BRITAIN AND NORTHERN IRELAND

1. Inland waterways of Scotland
Leith (Edinburgh), within the breakwaters.
Glasgow, Strathclyde Loch.
Crinan Canal, Crinan to Ardrishaig.
Caledonian Canal, the Canal sections.

2. Inland waterways of Northern Ireland

River Lagan, Lagan Weir to Stranmillis.

3. Inland waterways of East of England

River Wear (non-tidal), Old Railway Bridge, Durham to Prebends Bridge, Durham.
River Tees, upriver from Tees Barrage.
Grimsby Dock, inside of the locks.
Immingham Dock, inside of the locks.
Hull Docks, inside of the locks.
Boston Dock, inside the lock gates.
Aire and Calder Navigation, Goole Docks to Leeds; junction with Leeds and Liverpool Canal;
Bank Dole Junction to Selby (River Ouse Lock); Castleford Junction to Wakefield (Falling
Lock).
River Ancholme, Ferriby Sluice to Brigg.
Calder and Hebble Canal, Wakefield (Falling Lock) to Broadcut Top Lock.
River Foss, from (Blue Bridge) junction with River Ouse to Monk Bridge.
Fossdyke Canal, junction with River Trent to Brayford Pool.
Goole Dock, inside the lock gates.
Hornsea Mere, the whole Canal.
River Hull, from Struncheon Hill Lock to Beverley Beck.
Market Weighton Canal, river Humber Lock to Sod Houses Lock.
New Junction Canal, the whole Canal.
River Ouse, from Naburn Lock to Nun Monkton.
Sheffield and South Yorkshire Canal, Keadby Lock to Tinsley Lock.
River Trent, Cromwell Lock to Shardlow.
River Witham, Boston Sluice to Brayford Poole (Lincoln).

4. Inland waterways of Wales and West of England.

River Severn, above Llanthony and Maisemore Weirs.
 ECE/TRANS/SC.3/172/Rev.1
page 181
Appendix 1

River Wye, above Monmouth.

Cardiff, Roath Park Lake.
Port Talbot, within the enclosed docks.
Swansea, within the enclosed docks.
River Dee, above Barrelwell Hill water extraction point.
River Mersey, the docks (excluding Seaforth Dock).
River Lune, above Glasson Dock.
River Avon (Midland), Tewkesbury Lock to Evesham.
Gloucester, Gloucester City Docks Gloucester/Sharpness Canal.
Hollingworth Lake, the whole Lake.
Manchester Ship Canal, the whole Canal and Salford Docks including River Irwell.
Pickmere Lake, the whole Lake.
River Tawe, between Sea Barrage/Marina and the Morfa Athletics Stadium.
Rudyard Lake, the whole Lake.
River Weaver, below Northwich.

5. Inland waterways of South of England

River Nene, Wisbech Cut and River Nene to Dog-in-a-Doublet Lock.
River Great Ouse, Kings Lynn Cut and River Great Ouse below West Lynn Road Bridge.
Yarmouth, River Yare Estuary from a line drawn across the ends of the north and south entrance
piers, including Breydon Water.
Lowestoft, Lowestoft Harbour below Mutford Lock to a line drawn across the outer harbour
entrance piers.
Rivers Alde and Ore, above the entrance to the River Ore to Westrow Point.
River Deben, above the entrance of the River Deben to Felixstowe Ferry.
River Orwell and River Stour, from a line drawn from Fagbury Point to Shotley Point on the
River Orwell to Ipswich Dock; and from a line drawn north/south through Erwarton Ness on the
River Stour to Manningtree.
Chelmer & Blackwater, Canal Eastward of Beeleigh Lock.
River Thames and its tributaries, River Thames above Teddington Lock to Oxford.
River Adur and Southwick Canal, River Adur above the west end of Tarmac Wharf, and within
Southwick Canal.
River Arun, river Arun above Littlehampton Marina.
River Ouse (Sussex), Newhaven, River Ouse above the north end of North Quay.
Bewl Water, the whole lake.
ECE/TRANS/SC.3/172/Rev.1
page 182
Appendix 1

Grafham Water, the whole lake.

Rutland Water, the whole lake.
Thorpe Park Lake, the whole lake.
Chichester, east of a line joining Cobnor Point and Chalkdock Point.
Christchurch, within Christchurch Harbour excluding the Run.
Exeter Canal, the whole canal.
River Avon (Avon), Bristol City Docks, Netham Dam to Pulteney Weir.
 ECE/TRANS/SC.3/172/Rev.1
page 183
Appendix 2

APPENDIX 2
MODEL SHIP’S CERTIFICATE
(paragraph 2-1.2 of the Recommendations)

SHIP’S CERTIFICATE

(Reserved for State emblem)

NAME OF STATE

CERTIFICATE No ...................................................................................................................

Place, date

............................................................................

Competent authority on inspection of vessels

...................................................................

Seal

...................................................................

(Signature)

Remarks:
The vessel may be used for navigation by virtue of this certificate only while in the condition herein described.
In the event of major alterations or repairs, the vessel must undergo a special inspection before any new voyage.
The owner of the vessel, or their representative, must inform a competent authority on inspection of vessels of any
change in the name or ownership of the vessel, any remeasurement and any change in the registration number or
home port, and send the ship’s certificate to that authority for amendment.
ECE/TRANS/SC.3/172/Rev.1
page 184
Appendix 2

&HUWLILFDWH1ƒ   RIWKH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV

 
 1DPHRIYHVVHO  7\SHRIYHVVHO  8QLTXH(XURSHDQ9HVVHO,GHQWLILFDWLRQ
1XPEHU
  
 1DPHDQGGRPLFLOHRIRZQHU

 3ODFHRIUHJLVWUDWLRQDQGUHJLVWUDWLRQQXPEHU  +RPHSRUW
 
 <HDURIFRQVWUXFWLRQ  1DPHDQGORFDWLRQRIVKLS\DUG
 
 7KLVFHUWLILFDWHUHSODFH&HUWLILFDWH1R  LVVXHGRQ  E\WKH
  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV  


 7KHDERYHPHQWLRQHGYHVVHO 
VXEVHTXHQWWRWKHLQVSHFWLRQFDUULHGRXWRQ  
RQSUHVHQWDWLRQRIWKHFHUWLILFDWHLVVXHGRQ   
E\WKHUHFRJQL]HG&ODVVLILFDWLRQ6RFLHW\  
LVDFNQRZOHGJHGDVILWWRRSHUDWH  
RQZDWHUZD\VLQ]RQH V  
 
RQWKHZDWHUZD\VLQ]RQH V    
 
LQ« 1DPHVRI6WDWHV   
H[FHSWIRU 
 
 
RQWKHIROORZLQJZDWHUZD\VLQ 1DPHVRIWKH6WDWH   
 
 
DWWKHPD[LPXPDXWKRUL]HGGUDXJKWZLWKWKHULJJLQJVSHFLILHGEHORZ 
 
 7KHYDOLGLW\RIWKLVFHUWLILFDWHH[SLUHVRQ  


 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
 
6HDO

 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
 ECE/TRANS/SC.3/172/Rev.1
page 185
Appendix 2

&HUWLILFDWH1ƒ RIWKH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV

 
 7KHFHUWLILFDWHQXPEHU  XQLTXH(XURSHDQYHVVHOLGHQWLILFDWLRQQXPEHU  UHJLVWUDWLRQQXPEHU  DQGPHDVXUHPHQW
QXPEHU  DUHDIIL[HGZLWKWKHFRUUHVSRQGLQJVLJQVDWWKHIROORZLQJORFDWLRQVRQWKHYHVVHO
  
  
  
  

 7KHPD[LPXPDXWKRUL]HGGUDXJKWLVLQGLFDWHGRQHDFKVLGHRIWKHYHVVHO
 E\WZR  GUDXJKWPDUNV  
 E\WKHXSSHUPHDVXUHPHQWSODWHV   
7ZRGUDXJKWVFDOHVKDYHEHHQDSSOLHG   
7KHUHDUPHDVXUHPHQWVFDOHVVHUYHDVGUDXJKWVFDOHVWKH\KDYHEHHQVXSSOHPHQWHGIRUWKDWSXUSRVHE\ILJXUHV 
LQGLFDWLQJWKHGUDXJKWV 
 


 :LWKRXWSUHMXGLFHWRWKHUHVWULFWLRQV PHQWLRQHGLQLWHPVDQGWKHYHVVHOLVILWWR

 SXVK   EHSURSHOOHGLQDVLGHE\VLGHIRUPDWLRQ 

 LQULJLGIRUPDWLRQ   WRZ 

 ZLWKFRQWUROOHGDUWLFXODWLRQ   YHVVHOKDYLQJQRPRWLYHSRZHURILWVRZQ 

 EHSXVKHG   PRWRUL]HGYHVVHO 

 LQULJLGIRUPDWLRQ   XSVWUHDPRQO\ 

 DWWKHKHDGRIDULJLGIRUPDWLRQ   EHWRZHG 

 ZLWKFRQWUROOHGDUWLFXODWLRQ   DVDPRWRUL]HGYHVVHO 

 SURSHODVLGHE\VLGHIRUPDWLRQ   DVDYHVVHOZLWKQRPRWLYHSRZHURILWVRZQ 


 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
 
6HDO

 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
ECE/TRANS/SC.3/172/Rev.1
page 186
Appendix 2

&HUWLILFDWH1ƒ   RIWKH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV

 
 $XWKRULVHGIRUPDWLRQV
  7KHYHVVHOLVDXWKRULVHGWRSURSHOWKHIROORZLQJIRUPDWLRQV 
 )RU 5HVWULFWLRQVUHVXOWLQJIURPFKDSWHUVDQG 
 PDWLRQ 0D[GLPHQVLRQV 1DYLJDWLRQGLUHFWLRQDQGORDGVWDWXV 0D[LPXPZHWWHGVHFWLRQLQ  
ILJXUH P P 5HPDUNV
 83675($0 '2:1675($0 
 1R OHQJWK EUHDGWK ORDGHGW HPSW\ ORDGHGW HPSW\ XSVWUHDP GRZQVWUHDP  
           
           
           
           
           
           
           
           



1 3 4
2 5

or Starboard
9
6 7 8

10 11
13
12

14 15 16
17
Other formations:

Key to symbols:
pusher Self-propelled vessel lighter


 &RXSOLQJV
7\SHRIFRXSOLQJ   1XPEHURIFRXSOLQJVSHUVLGH  
1XPEHURIFRXSOLQJFDEOHV   /HQJWKRIHDFKFRXSOLQJFDEOH  P
7HQVLOHVWUHQJWKSHUORQJLWXGLQDOFRXSOLQJ  N1 7HQVLOHVWUHQJWKSHUFRXSOLQJFDEOH   N1

1XPEHURIFDEOHZLQGLQJV   
 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
 
6HDO

 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
 ECE/TRANS/SC.3/172/Rev.1
page 187
Appendix 2

&HUWLILFDWH1ƒ RIWKH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV

 
 0HDVXUHPHQWFHUWLILFDWH1R  RIWKH  0HDVXUHPHQW2IILFHGDWHG  

D /HQJWKRYHUDOO P D %UHDGWKRYHUDOO P 19. 0D[LPXPGUDXJKW P 20. )UHHERDUG FP
E /HQJWK/ P E %UHDGWK% P  
 'HDGZHLJKW:DWHU  1XPEHURISDVVHQJHUV  1XPEHURISDVVHQJHUEHUWKV
GLVSODFHPHQW 
 WP   
 1XPEHURIZDWHUWLJKWFRPSDUWPHQWV  1XPEHURIKROGV  7\SHRIKDWFKFRYHU
  
 1XPEHURIPDLQSURSXOVLRQHQJLQHV  7RWDOSRZHUUDWLQJRIPDLQPHDQV  1XPEHURIPDLQSURSHOOHUV
RISURSXOVLRQ
  N: 
 1XPEHURIERZZLQGODVVHV  1XPEHURIVWHUQZLQGODVVHV
RIZKLFK««««««SRZHUHG RIZKLFK««««««SRZHUHG
 1XPEHURIWRZLQJKRRNV  1XPEHURIWRZLQJZLQFKHV
 RIZKLFK««««««««««««««SRZHUHG
 6WHHULQJJHDU
 1XPEHURIUXGGHUEODGHV 0DLQUXGGHUGULYH  PDQXDO   HOHFWULFK\GUDXOLF  
 RQPDLQUXGGHU   HOHFWULF   K\GUDXOLF  
 2WKHULQVWDOODWLRQV \HVQR  7\SH  

 )ODQNLQJUXGGHU )ODQNLQJUXGGHUGULYH  PDQXDO   HOHFWULFK\GUDXOLF  

 \HVQR    HOHFWULF   K\GUDXOLF  
 %RZUXGGHULQVWDOODWLRQ  ERZUXGGHU   5HPRWHFRQWURO  5HPRWHDFWLYDWLRQ 
 \HVQR   ERZWKUXVWHUV  \HVQR  \HVQR  
  RWKHULQVWDOODWLRQ  
 %LOJHSXPSLQJDQGGUDLQLQJHTXLSPHQW
 7RWDOFDOFXODWHGFDSDFLW\ 1XPEHURISRZHUGULYHQ 3XPSLQJFDSDFLW\ 1XPEHURIKDQGSXPSV 
ELOJHSXPSV
  OPLQ    OPLQ   

 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
 
6HDO

 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
ECE/TRANS/SC.3/172/Rev.1
page 188
Appendix 2

&HUWLILFDWH1ƒ   RIWKH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV

 
 1XPEHUDQGSRVLWLRQRIFORVLQJGHYLFHVUHIHUUHGWRLQ%
  

 $QFKRUV
 1XPEHURIERZDQFKRUV 7RWDOPDVVRIERZDQFKRUV 1XPEHURIVWHUQDQFKRUV 7RWDOPDVVRIVWHUQDQFKRUV 
    NJ    NJ 


 $QFKRUFKDLQV
 1XPEHURIERZDQFKRU /HQJWKRIHDFKFKDLQ 7HQVLOHVWUHQJWKRIHDFK  
FKDLQV FKDLQ
    P  N1   
 1XPEHURIVWHUQDQFKRU /HQJWKRIHDFKFKDLQ 7HQVLOHVWUHQJWKRIHDFK  
FKDLQV FKDLQ
    P  N1   


 0RRULQJFDEOHV
 VWFDEOH  PORQJZLWKDWHQVLOHVWUHQJWK  N1  
 QGFDEOH  PORQJZLWKDWHQVLOHVWUHQJWK  N1  
 UGFDEOH  PORQJZLWKDWHQVLOHVWUHQJWK  N1  


 7RZLQJFDEOHV
  ZLWKDOHQJWKRI  PDQGDWHQVLOHVWUHQJWKRI  N1  
  ZLWKDOHQJWKRI  PDQGDWHQVLOHVWUHQJWKRI  N1  


 9LVXDODQGDXGLEOHVLJQDOV 
7KHOLJKWVIODJVEDOOVIORDWVDQGDXGLEOHZDUQLQJGHYLFHVXVHGIRUVLJQDOOLQJDQGWRHPLWWKHYLVXDODQGDXGLEOHVLJQDOV
SUHVFULEHGE\WKH(XURSHDQ&RGHIRU,QODQG:DWHUZD\V &(91, DUHFDUULHGRQERDUGDVDUHWKHVWDQGDORQHHPHUJHQF\
OLJKWVSUHVFULEHGE\&(91,
 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
 
6HDO

 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
 ECE/TRANS/SC.3/172/Rev.1
page 189
Appendix 2

&HUWLILFDWH1ƒ RIWKH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV

 
 2WKHUHTXLSPHQW 
KHDYLQJOLQH 9RLFHFRPPXQL  DOWHUQDWLYHWZRZD\ 
JDQJZD\ZLWKKDQGUDLO FDWLRQV\VWHP  VLPXOWDQHRXVWZRZD\WHOHSKRQH 
    LQWHUQDOUDGLRWHOHSKRQHOLQN 
 JDIIKRRN 5DGLRWHOHSKRQH  YHVVHOWRYHVVHOVHUYLFH
 ILUVWDLGNLW LQVWDOODWLRQ  QDXWLFDOLQIRUPDWLRQVHUYLFH
    YHVVHOSRUWDXWKRULW\VHUYLFH
 SDLURIELQRFXODUV
 QRWLFHFRQFHUQLQJUHVFXH
 RISHUVRQVRYHUERDUG
 ILUHUHVLVWDQWUHFHSWDFOHV &UDQHV  LQDFFRUGDQFHZLWK 
 HPEDUNDWLRQVWDLUZD\ODGGHU    FUDQHVZLWKDXVHIXOORDGQRWH[FHHGLQJNJ 
 )LUHILJKWLQJDSSOLDQFHV 1XPEHURISRUWDEOH )L[HGVSULQNOHUV\VWHP V  1RQH1XPEHU   
 H[WLQJXLVKHUV  2WKHUIL[HGILUHILJKWLQJV\VWHP V  1RQH1XPEHU   
      

1XPEHURIILUHSXPSV 1XPEHURIK\GUDQWV 1XPEHURIKRVHV 

   
7KHSRZHUHGGUDLQDJHSXPSUHSODFHVDILUHSXPS <HV1R  
 /LIHVDYLQJHTXLSPHQW 
1XPEHURIOLIHEXR\V 
 
$OLIHMDFNHWIRUHDFKSHUVRQUHJXODUO\RQERDUG  
2WKHULQGLYLGXDOOLIHVDYLQJHTXLSPHQWRQSDVVHQJHU  
YHVVHOV 
««««««««««««««««««««««««««««««««««««««««««««««««««««« 
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««

$VKLS¶VERDWZLWKDVHWRIRDUVRQHPRRULQJOLQHDQGDEDOHU   
2WKHUFROOHFWLYHOLIHVDYLQJHTXLSPHQWRQSDVVHQJHUYHVVHOV   
««««««««««««««««««««««««««««««««««««««««««««««««««««« 
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
 6SHFLDOZKHHOKRXVHDUUDQJHPHQWVIRUVWHHULQJRQUDGDUE\RQHSHUVRQ    
$SSURYHGIRUVWHHULQJRQUDGDUE\RQHSHUVRQ   


 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
6HDO  
 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
ECE/TRANS/SC.3/172/Rev.1
page 190
Appendix 2

&HUWLILFDWH1ƒ   RIWKH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV

 
 7KHYHVVHOLVDXWKRUL]HGIRURSHUDWLQJPRGHV$ $ %  
 9HVVHOHTXLSPHQWLQDFFRUGDQFHZLWK 
7KHYHVVHO FRPSOLHV  GRHVQ¶WFRPSO\ ZLWK
,QDFFRUGDQFHZLWKWKHPLQLPXPFUHZVKRXOGEHLQFUHDVHGDVIROORZV VKRXOGQRWEHLQFUHDVHG 
 

  2SHUDWLQJPRGH 
   $  $   % 

 2UGLQDU\FUHZPDQ    
 5HSODFHPHQWRIWKHRUGLQDU\FUHZPDQE\DQHQJLQHPLQGHU    
2EVHUYDWLRQVDQGVSHFLDOFRQGLWLRQV 
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««
 0LQLPXPFUHZLQDFFRUGDQFHZLWK$UWLFOH 
 

  2SHUDWLQJPRGH 
  $  $   % 

 %RDWPDVWHU    
 +HOPVPDQ    
 $EOHFUHZPDQ    
 2UGLQDU\FUHZPDQ    
 (QJLQHHU    
 (QJLQHPLQGHU    
 
2EVHUYDWLRQVDQGVSHFLDOFRQGLWLRQV 
««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««
 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
 
6HDO

 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
  
 ECE/TRANS/SC.3/172/Rev.1
page 191
Appendix 2

 ([WHQVLRQFRQILUPDWLRQ RIFHUWLILFDWHYDOLGLW\ 3HULRGLFDOVSHFLDO LQVSHFWLRQFHUWLILFDWH 

7KH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOVLQVSHFWHGWKHYHVVHORQ   
$FHUWLILFDWHGDWHG  IURPWKH  5HFRJQL]HG&ODVVLILFDWLRQ6RFLHW\ 
 
ZDVSUHVHQWHGWRWKH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV   
5HDVRQIRUWKHLQVSHFWLRQFHUWLILFDWH  
 
 
,QYLHZRIWKHLQVSHFWLRQUHVXOWFHUWLILFDWH WKHSHULRGRIYDOLGLW\IRUWKHFHUWLILFDWHLVPDLQWDLQHGH[WHQGHG  
XQWLO   
    
 3ODFH   'DWH   
 
6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 'HOHWHDVDSSURSULDWH  6LJQDWXUH 
 ([WHQVLRQFRQILUPDWLRQ RIFHUWLILFDWHYDOLGLW\ 3HULRGLFDOVSHFLDO LQVSHFWLRQFHUWLILFDWH 
7KH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOVLQVSHFWHGWKHYHVVHORQ   
$FHUWLILFDWHGDWHG  IURPWKH  5HFRJQL]HG&ODVVLILFDWLRQ6RFLHW\ 
 
ZDVSUHVHQWHGWRWKH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV   
5HDVRQIRUWKHLQVSHFWLRQFHUWLILFDWH  
 
 
,QYLHZRIWKHLQVSHFWLRQUHVXOWFHUWLILFDWH WKHSHULRGRIYDOLGLW\IRUWKHFHUWLILFDWHLVPDLQWDLQHGH[WHQGHG  
XQWLO   
    
 3ODFH   'DWH   
 
6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 'HOHWHDVDSSURSULDWH  6LJQDWXUH 
 ([WHQVLRQFRQILUPDWLRQ RIFHUWLILFDWHYDOLGLW\ 3HULRGLFDOVSHFLDO LQVSHFWLRQFHUWLILFDWH 
7KH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOVLQVSHFWHGWKHYHVVHORQ   
$FHUWLILFDWHGDWHG  IURPWKH  UHFRJQL]HG&ODVVLILFDWLRQ6RFLHW\ 
 
ZDVSUHVHQWHGWRWKH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV   
5HDVRQIRUWKHLQVSHFWLRQFHUWLILFDWH  
 
 
,QYLHZRIWKHLQVSHFWLRQUHVXOWFHUWLILFDWH WKHSHULRGRIYDOLGLW\IRUWKHFHUWLILFDWHLVPDLQWDLQHGH[WHQGHG  
XQWLO   
    
 3ODFH   'DWH   
 
6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 'HOHWHDVDSSURSULDWH  6LJQDWXUH 
ECE/TRANS/SC.3/172/Rev.1
page 192
Appendix 2

 ([WHQVLRQFRQILUPDWLRQ RIFHUWLILFDWHYDOLGLW\ 3HULRGLFDOVSHFLDO LQVSHFWLRQFHUWLILFDWH 

7KH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOVLQVSHFWHGWKHYHVVHORQ   
$FHUWLILFDWHGDWHG  IURPWKH  UHFRJQL]HG&ODVVLILFDWLRQ6RFLHW\ 
 
ZDVSUHVHQWHGWRWKH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV   
5HDVRQIRUWKHLQVSHFWLRQFHUWLILFDWH  
 
 
,QYLHZRIWKHLQVSHFWLRQUHVXOWFHUWLILFDWH WKHSHULRGRIYDOLGLW\IRUWKHFHUWLILFDWHLVPDLQWDLQHGH[WHQGHG  
XQWLO   
    
 3ODFH   'DWH   
 
6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 'HOHWHDVDSSURSULDWH  6LJQDWXUH 
 ([WHQVLRQFRQILUPDWLRQ RIFHUWLILFDWHYDOLGLW\ 3HULRGLFDOVSHFLDO LQVSHFWLRQFHUWLILFDWH 
7KH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOVLQVSHFWHGWKHYHVVHORQ   
$FHUWLILFDWHGDWHG  IURPWKH  UHFRJQL]HG&ODVVLILFDWLRQ6RFLHW\ 
 
ZDVSUHVHQWHGWRWKH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV   
5HDVRQIRUWKHLQVSHFWLRQFHUWLILFDWH  
 
 
,QYLHZRIWKHLQVSHFWLRQUHVXOWFHUWLILFDWH WKHSHULRGRIYDOLGLW\IRUWKHFHUWLILFDWHLVPDLQWDLQHGH[WHQGHG  
XQWLO   
    
 3ODFH   'DWH   
 
6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 'HOHWHDVDSSURSULDWH  6LJQDWXUH 
 ([WHQVLRQFRQILUPDWLRQ RIFHUWLILFDWHYDOLGLW\ 3HULRGLFDOVSHFLDO LQVSHFWLRQFHUWLILFDWH 
7KH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOVLQVSHFWHGWKHYHVVHORQ   
$FHUWLILFDWHGDWHG  IURPWKH  UHFRJQL]HG&ODVVLILFDWLRQ6RFLHW\ 
 
ZDVSUHVHQWHGWRWKH&RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV   
5HDVRQIRUWKHLQVSHFWLRQFHUWLILFDWH  
 
 
,QYLHZRIWKHLQVSHFWLRQUHVXOWFHUWLILFDWH WKHSHULRGRIYDOLGLW\IRUWKHFHUWLILFDWHLVPDLQWDLQHGH[WHQGHG  
XQWLO   
    
 3ODFH   'DWH   
 
6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 'HOHWHDVDSSURSULDWH  6LJQDWXUH 
 ECE/TRANS/SC.3/172/Rev.1
page 193
Appendix 2

 $WWHVWDWLRQUHODWLQJWROLTXHILHGJDVLQVWDOODWLRQ 
7KHOLTXHILHGJDVSODQWRQERDUGWKHYHVVHOKDVEHHQLQVSHFWHGE\WKHUHFRJQL]HGRIILFHU   
 
DQGDFFRUGLQJWRKLVKHUDFFHSWDQFHUHSRUWGDWHG  IXOILOVWKHFRQGLWLRQVODLGGRZQ 
7KHLQVWDOODWLRQLQFOXGHVWKHIROORZLQJJDVFRQVXPLQJDSSOLDQFHV 
 
 ,QVWDOODWLRQ 6HULDO1R 0RGHO 0DNH 7\SH 3RVLWLRQ 
       
       
       
       
       
       
       
       
       
       
       
       
       
       
 
7KLVDWWHVWDWLRQLVYDOLGXQWLO  
    
 3ODFH   'DWH   
 
6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 'HOHWHDVDSSURSULDWH  6LJQDWXUH 
 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
 
6HDO

 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
ECE/TRANS/SC.3/172/Rev.1
page 194
Appendix 2

 ([WHQVLRQRIWKHDWWHVWDWLRQUHODWLQJWRWKHOLTXHILHGJDVLQVWDOODWLRQ 
7KHSHULRGFRYHUHGE\WKHDWWHVWDWLRQUHODWLQJWROLTXHILHGJDV   
LQVWDOODWLRQ V 
GDWHG  LVH[WHQGHGXQWLO  
 IROORZLQJWKHVXSSOHPHQWDU\LQVSHFWLRQE\WKHUHFRJQL]HGRIILFHU  
 RQSUHVHQWDWLRQRIWKHDFFHSWDQFHUHSRUWGDWHG  
    
 3ODFH   'DWH   
 

6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 6LJQDWXUH  
 ([WHQVLRQRIWKHDWWHVWDWLRQUHODWLQJWRWKHOLTXHILHGJDVLQVWDOODWLRQ 
7KHSHULRGFRYHUHGE\WKHDWWHVWDWLRQUHODWLQJWROLTXHILHGJDV   
LQVWDOODWLRQ V 
GDWHG  LVH[WHQGHGXQWLO  
 IROORZLQJWKHVXSSOHPHQWDU\LQVSHFWLRQE\WKHUHFRJQL]HGRIILFHU  
 RQSUHVHQWDWLRQRIWKHDFFHSWDQFHUHSRUWGDWHG  
    
 3ODFH   'DWH   
 

6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 6LJQDWXUH  
 ([WHQVLRQRIWKHDWWHVWDWLRQUHODWLQJWRWKHOLTXHILHGJDVLQVWDOODWLRQ 
7KHSHULRGFRYHUHGE\WKHDWWHVWDWLRQUHODWLQJWROLTXHILHGJDV   
LQVWDOODWLRQ V 
GDWHG  LVH[WHQGHGXQWLO  
 IROORZLQJWKHVXSSOHPHQWDU\LQVSHFWLRQE\WKHUHFRJQL]HGRIILFHU  
 RQSUHVHQWDWLRQRIWKHDFFHSWDQFHUHSRUWGDWHG  
    
 3ODFH   'DWH   
 

6HDO &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 

 6LJQDWXUH  
 ECE/TRANS/SC.3/172/Rev.1
page 195
Appendix 2

 $QQH[WRFHUWLILFDWH1R  
««««««««««««««««««««««««««««««««««««««««««««««««««««« 
«««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««
«««««««««««««««««««««««««««««««««««««««««««««««««««««

 

 $PHQGPHQWWRLWHP V   
1HZWH[W  
 
 
 7KLVSDJHKDVEHHQUHSODFHG
3ODFHGDWH  &RPSHWHQWDXWKRULW\RQLQVSHFWLRQRIYHVVHOV 
  
 
6HDO

 6LJQDWXUH 
 'HOHWHDVDSSURSULDWH   
   &RQWLQXHGRQSDJH   
   (QGRIFHUWLILFDWH   
 ECE/TRANS/SC.3/172/Rev.1
page 197
Appendix 3

APPENDIX 3

SAFETY SIGNS AND SIGNALS TO BE USED

ON BOARD INLAND NAVIGATION VESSELS

Sketch 1
No access for
unauthorized persons Colours: red/white/black

Sketch 2
No naked lights or fires
and Colours: red/white/black
no smoking

Sketch 3
Fire-extinguisher panel
Colours: red/white

Sketch 4
General danger
Colours: black/yellow
ECE/TRANS/SC.3/172/Rev.1
page 198
Appendix 3

Sketch 5
Fire hose
Colours: red/white

Sketch 6
Fire extinguishing
equipment Colours: red/white

Sketch 7
Use ear protectors
Colours: blue/white

The pictograms used may differ slightly from or be more detailed than those given in
this appendix, provided that their meaning is not modified and that the differences and
adaptations do not render them incomprehensible.
Administrations may allow using on board vessels additional graphical safety signs
and signals which should as much as possible comply with the symbols recommended in the
relevant resolutions of the International Maritime Organization and the standards of the
International Organization for Standardization.
 ECE/TRANS/SC.3/172/Rev.1
page 199
Appendix 4

APPENDIX 4
ALTERNATIVE MANOEUVRABILITY TEST PROCEDURES
AND CRITERIA IN ACCORDANCE WITH 5-2.1
I. ALTERNATIVES
Alternative 1: Administrative Instructions Nos.1 and 2 of Annex II of the EU Directive
2006/87/EC laying down technical requirements for inland waterway vessels, as shown below in
Addendum 4-1.
Status: This alternative is obligatory on waterways subject to the EU Directive 2006/87/EC
within the European Union and as far as Member States do not apply derogations according to
Annex IV of the above-mentioned Directive, as well as waterways covered by the Revised
Convention for Rhine Navigation of 1868, as amended.
Alternative 2: Requirements set out in section 15, part 1 of the Rules for the Classification and
Construction of Inland Navigation Vessels of the Russian River Register, as shown below in
Addendum 4-2.
Status: This alternative is obligatory on waterways subject to the Code of Inland Water Transport
of the Russian Federation.
Alternative 3: Recommendations concerning the Technical and Navigational Characteristics of
Pushed Convoys of the Danube Commission as shown below in Addendum 4-3.
Status: This alternative is a recommendation.

II. ENTRIES ON THE SHIP’S CERTIFICATE IN ACCORDANCE WITH 5-2.2

In accordance with 5-2.2 the competent authority on the inspection of vessels shall
enter into the ship’s certificate under item 52 which of the above-mentioned alternatives has
been applied for the navigation tests.

III. ADDENDA
ECE/TRANS/SC.3/172/Rev.1
page 200
Appendix 4

Addendum 4-1

ADMINISTRATIVE INSTRUCTIONS 1 AND 2 OF ANNEX II OF

THE EU DIRECTIVE 2006/87/EC
I. ADMINISTRATIVE INSTRUCTION N° 1 IN ACCORDANCE WITH ARTICLE 1.07
OF ANNEX II OF THE DIRECTIVE
Requirements relating to the capacity for evasive action and turning
(Articles 5.09 and 5.10 together with Articles 5.02 (1), 5.03 (1), 5.04 and 16.06)
1. General conditions and conditions relating to the evasive action test
1.1 According to Article 5.09, vessels and convoys shall be able to take evasive action in good
time and the capacity for such action shall be proved by evasive action manoeuvres in the test
area referred to in Article 5.03. This shall consist of simulated evasive action to port and
starboard, under specific conditions in which the limit values of time shall be complied with in
order to reach specific turning speeds relative to the evasive action and subsequent correction of
course.
The requirements of paragraph 2 shall be satisfied during tests, with a keel clearance equal
to at least 20 % of the draught, but not less than 0.50 m.
2. Evasive action test procedure and recording of data
(Diagram in annex 1)
2.1 Evasive action shall be performed as follows:
With the vessel or convoy under way at a constant speed of Vo = 13 km/h relative to the
water, at the start of the manoeuvre (time to = 0 s, turning speed r = 0°/min, rudder angle įo = 0°,
selected engine speed kept constant), evasive action to port or starboard is produced by changing
the rudder angle. The rudder shall be placed at an angle į, or the rudder unit at an angle į in the
case of an active rudder, at the start of the manoeuvre, in accordance with the indications given
in 2.3. The rudder angle į (e.g. 20° to starboard) shall be maintained until the value r1 of the
turning speed referred to in 2.2 for the corresponding dimensions of the vessel or convoy is
reached. When the turning speed r1 is reached, the time t1 should be noted and the rudder set at
the same angle on the other side (e.g. 20° to port) so as to complete the evasive action and
correct the course, i.e., to reduce the turning speed to r2 = 0 and to raise it again to the value
given in 2.2. When the turning speed r2 = 0 is reached, the time t2 shall be noted. When the
turning speed r3 given in 2.2 is reached, the helm must be reversed to the same angle į, so as to
complete the turning movement. The time t3 shall be noted. When the turning speed r4 = 0 is
reached, the time t4 shall be noted and the vessel or convoy returned to its original course by the
requisite rudder movements.
2.2 The following limit values shall be complied with to reach turning speed r according to the
dimensions of the vessels or convoys and the depth of water h:
 ECE/TRANS/SC.3/172/Rev.1
page 201
Appendix 4

'HVLJ 'LPHQVLRQVRIYHVVHOVRUFRQYR\V 7XUQLQJVSHHGWREH /LPLWYDOXHVIRUWKHWLPHW V 

QDWLRQ /[% FRPSOLHGZLWKU U LQVWLOOZDWHUDQGLQGHHSZDWHU
°PLQ 
  į ° į ° K7 K7 K7!
 $OOVHOISURSHOOHGYHVVHOVDQGVLQJOHILOH °PLQ °PLQ V V V
FRQYR\V≤[P

 6LQJOHILOHFRQYR\VXSWR[PRU
°PLQ °PLQ V V V
WZRDEUHDVWFRQYR\VXSWR[P

 7ZRDEUHDVWFRQYR\V≤[ °PLQ °PLQ V V V

 7ZRDEUHDVWFRQYR\VXSWR[PRU
°PLQ °PLQ   
WKUHHDEUHDVWFRQYR\VXSWR[P
*) As established by the nautical expert

The times t1, t2, t3 and t4 required to reach turning speeds r1, r2, r3 and r4 shall be recorded
in the report contained in annex 2. The t4 values shall not exceed the limits established in the
table.
2.3 Four evasive manoeuvres at least shall be effected, namely:
• to starboard with a rudder angle į = 20°
• to port with a rudder angle į = 20°
• to starboard with a rudder angle į = 45°
• to port with a rudder angle į = 45°.
If necessary (e.g. in the case of the non reliability of the values measured or of
unsatisfactory manoeuvres), the evasive action shall be repeated. The turning speeds listed in 2.2
and the time limits should be complied with. For active rudders or special types of rudder, a
position į of the rudder unit or rudder angle į other than į = 20° and į = 45° may be selected,
according to the expert's assessment, based on the type of rudder equipment.
2.4 In order to determine the turning speed, a rate-of-turn indicator conforming to the
minimum requirements and test conditions for rate-of-turn indicators shall be on board.
2.5 In accordance with Article 5.04, the degree of loading during the evasive action test shall
be between 70 % and 100 % of the maximum deadweight. If the test is performed with a smaller
load, approval for downstream and upstream navigation shall be restricted to that load limit.
The procedure for evasive action and the terms used are represented in a diagram annexed
to this document.
3. Turning capability
The turning capability of vessels and convoys whose length (L) does not exceed 86 m and
width (B) does not exceed 22.90 m shall be considered adequate under Article 5.10, in
conjunction with Article 5.02 (1), when during an upstream turning manoeuvre based on an
initial speed relative to the water of 13 km/h and observing the keel clearance conditions of
ECE/TRANS/SC.3/172/Rev.1
page 202
Appendix 4

paragraph 1.2, the limit values for stopping facing downstream established in Administrative
Instruction No. 2 are complied with.
4. Other requirements
4.1 Notwithstanding paragraphs 1 to 3, the following requirements shall be met:
(a) For manually controlled rudder equipment, a single turn of the wheel shall
correspond to a rudder angle of at least 3°;
(b) For mechanically controlled rudder equipment, when the rudder is at maximum
depth, it shall be possible to achieve an average angular velocity of 4°/s over the
rudder's entire rotational field.
This requirement shall also be met, with the vessel at full speed, for rudder settings from
35° port to 35° starboard. In addition, it should be ascertained that the rudder holds maximum
angle at maximum propelling power. For active rudder equipment or special types of rudder,
this provision applies by analogy.
4.2 If any of the additional equipment referred to in Article 5.05 has been needed, it shall meet
the requirements of chapter 6, and the following particulars shall be entered in item 52 of the
ship’s certificate: “Flanking rudders*/forward installation of the rudder*/other equipment*
is*/are* necessary to comply with the manoeuvrability requirements of chapter 5”.
*) Delete as necessary.

5. Recording of data and reports

The measurements, reports and recording of data shall be carried out according to the
procedure set out in annex 2.
Annex 1
Diagram of the evasive action manoeuvre

į
į,r
to = Start of manoeuvre
t1 = Time to reach turning point r1
t2 = Time to reach turning speed r0
(r2 = 0)
t3 = Time to reach turning speed r3
t4 = Time to reach turning speed
r4 = 0 (end of evasive action)
į = rudder angle [°]
r = Angular velocity [°/min]
 ECE/TRANS/SC.3/172/Rev.1
page 203
Appendix 4

Annex 2
5HSRUWRQHYDVLYHDFWLRQDQGWXUQLQJFDSDELOLWLHV
,QVSHFWLRQFRPPLVVLRQ 
'DWH  
1DPH 
1DPHRIYHVVHO 
2ZQHU 
7\SHRIYHVVHO 6HFWRU
RUFRQYR\  6FDOH P  

/[% P[P  'HSWKRIZDWHU P  

7WHVW P  
/RDG  RIPD[LPXP
GXULQJWHVW >W@ GHDGZHLJKW 

5DWHRIWXUQLQGLFDWRU
7\SH 

7\SHRIUXGGHUFRQVWUXFWLRQQRUPDOFRQVWUXFWLRQVSHFLDOFRQVWUXFWLRQ 
$FWLYHUXGGHUHTXLSPHQW\HVQR 

5HVXOWVRIHYDVLYHDFWLRQPDQRHXYUHV

5XGGHUDQJOHİRUİ DWZKLFKHYDVLYHDFWLRQFRPPHQFHV
&RPPHQWV
7LPHUHTXLUHG DQGWXUQLQJVSHHGWREHFRPSOLHGZLWKU U
WWRWIRUWKH į °67$5  į °3257  į °67$5  į °3257  
HYDVLYHDFWLRQ į 67$5  į 3257  į 67$5  į 3257 
U U °PLQ U U °PLQ 
W V      
W V      
W V      
W V      
/LPLWYDOXHW /LPLWYDOXHW  V 
DFFRUGLQJWR
7XUQLQJFDSDELOLW\  

3RVLWLRQDWVWDUWRIWXUQLQJPDQRHXYUH NS

3RVLWLRQDWHQGRIWXUQLQJPDQRHXYUH NS

6WHHULQJDSSDUDWXV   

7\SHRIRSHUDWLRQPDQXDOPRWRUL]HG 
5XGGHUPRYHPHQWIRUHDFKWXUQRIWKHZKHHO  ƒV

$QJXODUYHORFLW\RIWKHUXGGHURYHUWKHZKROHILHOG  ƒV

$QJXODUYHORFLW\RIWKHUXGGHURYHUWKHVHFWRU ƒ3RUWWRƒ6WDUERDUG ƒV

    

'HOHWHDVQHFHVVDU\
ECE/TRANS/SC.3/172/Rev.1
page 204
Appendix 4

II. ADMINISTRATIVE INSTRUCTION NO. 2 IN ACCORDANCE WITH ARTICLE 1.07

OF THE ANNEX II OF THE DIRECTIVE
Requirements concerning prescribed maximum speed,
stopping capacity and capacity for going astern
(Articles 5.06, 5.07 and 5.08 in relation to Articles 5.02 (1); 5.03 (1); 5.04 and 16.06)
1. Maximum prescribed speed in accordance with Article 5.06
The speed relative to the water is adequate within the meaning of Article 5.06, paragraph 1,
when it reaches at least 13 km/h. During tests, the following conditions must be met as in the
case of the stopping test:
(a) The conditions of keel clearance set out in paragraph 2.1 must be complied with,
(b) The measurements, entries in test reports and registration of test data must be carried
out.
2. Stopping capacity and navigability while going astern prescribed in accordance with
Articles 5.07 and 5.08
2.1 Vessels and convoys are able to stop facing downstream in good time in accordance with
Article 5.07, paragraph 1, when this is proved in the course of the test of stopping relative to the
bank facing downstream at an initial speed through the water of 13 km/h, with a keel clearance
equal to at least 20 % of the draught but not less than 0.50 m.
(a) In running water (current velocity of: 1.5 m/s), stopping relative to the water shall be
effected over a distance measured relative to the bank of:
550 m for vessels and convoys of:
• length L > 110 m and
• width B > 11.45 m
or
480 m for vessels and convoys of:
• length L < 110 m and
• width B < 11.45 m.
The stopping manoeuvre is completed on coming to a stop relative to the bank.
(b) In still water (current velocity of less than 0.2 m/s), stopping relative to the water
must be effected over a distance, measured relative to the bank of:
not more than 350 m for vessels and convoys of:
• length L > 110 m and
• width B > 11.45 m
or
305 m for vessels and convoys of:
• length L < 110 m and
• width B < 11.45 m.
In still water, a test shall also be performed to establish that a speed of not less than
6.5 km/h can be reached when going astern.
 ECE/TRANS/SC.3/172/Rev.1
page 205
Appendix 4

The measurements, inclusion in test reports and recording of the test data referred to in (a)
or (b) shall be effected in accordance with the procedure set out in annex 1.
Throughout the test, the vessel or the convoy shall have adequate manoeuvrability.
2.2 Under Article 5.04, during the test, vessels shall be loaded as far as possible to 70–100 %
of their deadweight. The degree of loading shall be evaluated in accordance with annex 2.
When the load of the vessel or the convoy is less than 70 % at the time of the test, the permitted
displacement in downstream navigation shall be determined on the basis of the actual load,
provided that the limit values of paragraph 2.1 are respected.
2.3 If the actual values of the initial speed and current velocity at the time of the test do not
meet the condition established in 2.1, the results obtained shall be evaluated according to the
procedure described in annex 2.
If the permitted difference in respect of the initial speed of 13 km/h shall be not more than
± 1 km/h, and the current velocity in running water must be between 2.3 and 2.2 m/s, otherwise
the tests must be repeated.
2.4. The maximum permitted displacement for vessels and convoys in downstream navigation
shall be established on the basis of the tests and entered in the ship’s certificate.
Annex 1
MEASUREMENT, REPORT AND RECORDING OF
DATA COLLECTED DURING STOPPING MANOEUVRE TESTS
1. Stopping manoeuvre
The vessels and convoys referred to in Chapter V shall perform a test in running water or
in still water, in a test sector, to prove that they are capable of stopping facing downstream with
the help of their propelling installations without the use of anchors. The stopping manoeuvre
shall, in principle, be conducted in accordance with figure 1. It begins when the vessel is
travelling at a steady speed - 13 km/h relative to the water, as far as possible be reversing the
engines from “ahead” to “astern” (point A of the order “stop”) and is completed when the
vessel is stationary relative to the bank (point E v = 0 relative to the bank or point D = point
E v = 0 relative to the water and relative to the bank if the stopping manoeuvre is carried out
in still water.
When stopping manoeuvres are carried out in running water, the position and the moment
of stopping relative to the water should also be recorded (the boat moves at the speed of the
current; point D v = 0 relative to the water).
The data measured shall be entered in a report from as illustrated in the graph of table 1.
Before the stopping manoeuvre takes place, the fixed data should be entered at the top of the
form.
The average speed of the current ( v STR ) in the navigable channel shall be determined, if
known, on the basis of the reading scale, or by measuring the movement of a floating body, and
shall be entered in the report.
ECE/TRANS/SC.3/172/Rev.1
page 206
Appendix 4

In principle, the use of current metres is permitted to determine the speed of the vessel
relative to the water during the stopping manoeuvre, if this enables the sequence of movements
and measurements described above to be recorded.
2. Recording the data measured and entering them in the report (table 1)
For the stopping manoeuvre, the initial speed relative to the water must first of all be
determined. This can be done by measuring the time taken to travel between two markers on
land. In running water, the average speed of the current must be taken into consideration.
The stopping manoeuvre is initiated by the order “stop” A , given on passing a marker on
land. Passage of the land marker is recorded at a point perpendicular to the axis of the vessel and
must be entered in the report. The passage of all other land markers during the stopping
manoeuvre is recorded in the same way and each marker (e.g. kilometre post) and the time it is
passed are noted in the report.
The values measured must, if possible, be recorded at intervals of 50 m. In each case, note
should be taken of the time when points B and C – if possible–as well as points D and
E are reached and the position evaluated. The data concerning the number of revolutions need
not be recorded in the report, but should be noted to permit more accurate control of the initial
speed.
3. Description of the execution of the stopping manoeuvre
The execution of the stopping manoeuvre according to figure 1 shall be presented in the
form of a diagram. First of all, the distance-time curve must be plotted using the measurements
entered in the rest report and points A and E marked. It will then be possible to determine the
average speed between two measurement points and to plot the speed/time curve.
This is done as follows (see figure 1):
By determining the quotient of the difference of position over the difference in time ǻs/ǻt,
the average speed of the vessel for this period may be calculated.
During the interval between 0 sec. and 10 sec., the distance from 0 m to 50 m is covered.
ǻs/ǻt = 50 m/10 s – 5.0 m/s = 18.0 km/h
This value is entered as the average speed for a 5 sec. abscissa.
During the second interval, from 10 sec. to 20 sec., a distance of 45 m is covered.
ǻs/ǻt = 45 m/10 s = 4.5 m/s = 16.2 km/h
Perpendicular to marker D , the vessel has stopped relative to the water i.e. current
speed is approximately 5 km/h.
 ECE/TRANS/SC.3/172/Rev.1
page 207
Appendix 4

Figure 1: Execution of the stopping manoeuvre

Key to symbols
A “stop” order
B propeller stopped
C propeller in reverse

D v = O relative to the water

E v = O relative to the bank

v speed of vessel
vL v relative to the bank
s distance covered relative to the bank
t time elapsed
 Table 1: Report of the stopping manoeuvre page 208
 ,QVSHFWLRQ&RPPLVVLRQ &DWHJRU\RIYHVVHORUFRQYR\ 6HFWRU
Appendix 4

/[%>P@ 6FDOH >P@

'DWH 7WHVW>P@ 'HSWKRIZDWHU >P@

1DPH /RDGLQJ7HVW>W@ *UDGLHQW >PNP@

-RXUQH\1R RIPD[LPXPGHDGZHLJKW 9675 >NPK@

ECE/TRANS/SC.3/172/Rev.1

  3RZHURISURSXOVLRQHQJLQHV3%>N:@  >PV@

  3URSXOVLRQV\VWHPDQQH[WDEOH 0D[ZDWHU >P@

GLVSODFHPHQW
  


3/$&( 7,0( ΔV ΔW Y,/ Q
2%6(59$7,216
>NLOSRXW@ >VHF@ >P@ >VHF@ >NPK@ >PLQ@


 ECE/TRANS/SC.3/172/Rev.1
page 209
Appendix 4

Annex 2
EVALUATION OF THE RESULTS OF THE STOPPING MANOEUVRE
1. Observance of the limit values in accordance with annex 1 must be verified on the basis of
the values recorded. When the conditions for the stopping manoeuvre differ substantially from
the standard conditions, or when there are doubts as to the observance of the limit values, the
results must be evaluated. The following procedure may be applied in calculating stopping
manoeuvres.

2. Theoretical stopping distances are determined under the standard conditions (sSOLL) of
paragraph 2.1 of the Administrative Instruction and under stopping manoeuvre conditions (sIST)
and are compared with the stopping distance measured (sMESSUNG). The corrected stopping
distance of the stopping manoeuvre under standard conditions (sNORM) is calculated as follows:

2.1 s SOLL limit value in accordance with paragraph 2.1(a) or (b) of the
s NORM = s MESSUNG ⋅ < Instruction
s IST
When the stopping manoeuvre has been effected by the calculation of sNORM with a load of
70 – 100 % of the maximum deadweight in accordance with paragraph 2.2 of the Administrative
Instruction, in order to calculate sSOLL and sIST, the water displacement (DSOLL = DIST)
corresponding to the load at the time of the test shall be used.

When in determining sNORM according to the 2.1 formula, the limit value in question proves
to have been exceeded or not reached, the value of sSOLL should be reduced or increased by the
variation of DSOLL so that the limit value is respected (sNORM = limit value in question). The
maximum water displacement permitted in downstream navigation is to be established
accordingly.

3. According to
the limit values
established in
paragraph 2.1 (a)
and (b) of the
Administrative
Instruction, only the
stopping distances
measured in Phase I
(“Full ahead”
reversed to “full
astern”): SI and
Phase II (End of
reversal until vessel
stops relative to the
water); SII are to be
calculated (see
figure 1).
ECE/TRANS/SC.3/172/Rev.1
page 210
Appendix 4

One total stopping distance is then:

3.1 Sges = SI + SII
4. The stopping distances alone are to be calculated as follows:
Calculation formulae: with the following coefficients
4.1 S I = k1 ⋅ v L ⋅ t l  t l ≤ 20 s  - k1 according to table 1

D⋅g § v ·
S II = k 2 ⋅ v II ⋅ − ¨¨ k 4 + STR ¸¸ 
2
4.2 - k2, k3, k4 according to table 1
k 2 ⋅ FPOR + RTmII ⋅ RG © v II ¹

RTmII = §¨ · ⋅ (k ⋅ k ⋅ (v − v ))2 
RT - k5, k7 according to table 1
4.3 ¸
©
2
v ¹ 7 6 L STR
- RT/v2 according to table 3
4.4 RG = i ⋅ D ⋅ ρ ⋅ g ⋅ 10 −6 
4.5 v II = k 6 ⋅ (v L − v STR )  - k6 according to table 1
4.6 FPOR = f ⋅ P8  - f according to table 2
s II
4.7 t II = 
§ v · - k4 according to table 1
v II − ¨¨ k 4 + STR ¸¸
© v II ¹
In formulae 4.1 to 4.7:
vL Speed relative to the bank at the start of reversal (m/s)
tI Reversal time (s)
vII Speed relative to the water at the end of reversal (m/s)
D Water displacement (m3)
FPOR Tractive force at the fixed point, in reverse (kN)
PB Power of propulsion engine (kW)
RTmII Average resistance during phase II, to be determined (kN)
using the diagram for calculating resistance
RG Resistance to gradient (kN)
i Gradient in m/km (in the absence of date = 0.16) (m/km)
vSTR Average speed of current (m/s)
g Acceleration of gravity (9.81) (m/s2)
ρ Density of water, ρ fresh water = 1,000 (kg/m3)
T Maximum deadweight (of vessel or convoy) (m)
h Depth of water (m)
B Width (m)
L Length (m)
 ECE/TRANS/SC.3/172/Rev.1
page 211
Appendix 4

The coefficients for the formulae 4.1, 4.2, 4.3, 4.4, 4.5, 4.6 and 4.7 can be found in tables
below.
Table 1: k factors for
a. SELF-PROPELLED VESSELS and CONVOYS, single file
b. Two-abreast CONVOYS
c. Three-abreast CONVOYS

 D E F 8QLWV

N    

N
kg ⋅ s 2
   
m4
N    

N    

N    

N    

Table 2: Coefficient f for ratio between the tractive force at the fixed point
in reverse and the power of the propulsion engines

3URSXOVLRQV\VWHP I 8QLWV

0RGHUQQR]]OHVZLWKURXQGHGUHDUHGJH  N1N:

2OGQR]]OHVZLWKVKDUSUHDUHGJH  N1N:
3URSHOOHUVZLWKQRQR]]OH  N1N:
6WHHULQJSURSHOOHUVZLWKQR]]OHV JHQHUDOO\VKDUSUHDUHGJH   N1N:
6WHHULQJSURSHOOHUVZLWKQRQR]]OHV  N1N:
ECE/TRANS/SC.3/172/Rev.1
page 212
Appendix 4

Table 3: Diagram concerning the calculation of resistance

To determine the value of RT/v2 in relation to D1/3 [B + 2T]:

RT
v2

ª kN ⋅ s 2 º
« 2 »
¬ m ¼

(B + 2T )
1
3
D
 ECE/TRANS/SC.3/172/Rev.1
page 213
Appendix 4

EXAMPLES OF THE APPLICATION OF ANNEX 2

(for the use of the results of the stopping tests)
EXAMPLE I
1. Data relating to the convoy and its components
Formation: ordinary self-propelled vessel with a (Europa IIa) pushed barge coupled abreast

 />P@ %>P@ 7PD[>P@ 7JI PD[>W@ 'PD[>P@ 3%>N:@

6HOISURSHOOHGYHVVHO      

3XVKHGEDUJH      
&RQYR\      
Propulsion system of the self-propelled vessel: modern nozzles with rounded rear edge
* Tgf = deadweight.
2. Values measured during the stopping manoeuvre

6SHHGRIFXUUHQW Y675   PV ≈NPK

,67

6SHHGRIYHVVHO UHODWLYHWRWKHZDWHU  96   PV ≈NPK

,67

6SHHGRIYHVVHO UHODWLYHWRWKHEDQN  9/   PV ≈NPK

,67

5HYHUVDOWLPH PHDVXUHG  SRLQW

A WR C  W,  V 

6WRSSLQJGLVWDQFHUHODWLYHWRZDWHU SRLQWWR
A D    V0(6681* P

'HJUHHRIORDGLQJ SRVVLEO\HVWLPDWHG  ',67  P ≈'PD[

$FWXDOGUDXJKWRIFRQYR\ 7,67  P ≈7PD[

3. Limit value according to 2.1 (a) or (b) to be compared with sNORM

Since B > 11.45 m and since the convoy is in running water, the following is applicable for
this convoy under 2.1 (a):
sNORM ” 550 m
4. Determination of corrected stopping distance compared to standard conditions
- Measurement according to annex 1 (see 2)
sMESSUNG = 340 m
ECE/TRANS/SC.3/172/Rev.1
page 214
Appendix 4

- Calculation to be made:
sIST sum of
sLIST (according to formula 4.1 of annex 2 with vLIST)
and sIIIST (according to formulae 4.2, 4.3, 4.4, 4.5 and 4.6 of annex 2 with real
speeds vIIIST, vSTRIST, DIST)
sSOLL sum of
sISOLL (according to formula 4.1 or annex 2 with vLSOLL)
and sIISOLL (according to formulae 4.2 to 4.6 of annex 2 with the standard speeds
according to 2.1 of the Administrative Instruction and given that the
degree of loading is greater than 70 % (= 80 %)): DSOLL = DIST and
TSOLL = TIST
- to be checked:
sSOLL
s NORM = sMESSUNG ⋅ ≤ 555 m
s IST

4.1 Initial data for the calculation

Table 1
for sIIST and sISOLL k1 = 0.95

for sIIIST and sIISOLL k2 = 0.12

k3 = 1.15
k4 = 0.48
k6 = 0.85
k7 = 0.55
Table 2 (for modern nozzles with rounded rear edge)
f = C.118
4.2 Calculation of sIST
(a) sIIST with the values measured during the stopping manoeuvre (formula 4.1)

s I IST = k1 ⋅ v LIST ⋅ t I IST

s I IST = 0.95 ⋅ 4.9 ⋅ 16 = 74.5 m

(b) Formula for sIIIST

DIST ⋅ g § v STRIST ·
s II IST = k 2 ⋅ v 2 II IST ⋅ ⋅ ¨ k4 + ¸
k 3 ⋅ FPOR + RTmII IST RG ¨ v II IST ¸
© ¹
 ECE/TRANS/SC.3/172/Rev.1
page 215
Appendix 4

(c) Calculation of RTmIIIST according to table 3 and formula 4.3 of annex 2

= 51791 / 3 = 17.3 [m]
1/ 3
DIST

DIST
1/ 3
= (B + 2 ⋅ TIST ) = 17.3 ⋅ (22.8 + 5.92) = 495.8 [m ]
2

RT ª kN ⋅ s 2 º
according to table 3 = 10.8 « »
v2 ¬ m ¼
2

vLIST − vSTR IST = 4.9 − 1.4 = 3.5 m/s

RTmII IST =
RT
v2
( (
⋅ k 7 ⋅ k 6 ⋅ v LIST − v STRIST ))
2
= 10.8 ⋅ (0.55 ⋅ 0.85 ⋅ 3.5) = 28.8 [kN ]
2

(d) Calculation of resistance to gradient RG according to formula 4.4

RG = 10−6 ⋅ (0.16 ⋅ DIST ⋅ ρ ⋅ g ) = 10 −6 ⋅ (0.16 ⋅ 5179 ⋅ 1000 ⋅ 9.81) = 8.13 [kN ]

(e) Calculation of devIIIST according to formula 4.5

( )
vII IST = k6 ⋅ vLIST − vSTRIST = (0.85 ⋅ 3.5) = 2.97 [m/s]
2
v 2 II IST = 8.85 [m/s]

(f) Calculation of FPOR according to formula 4.6 and table 2

FPOR = 0.118 ⋅ 1500 = 177 [kN ]
(g) Calculation of sIIIST using formula (b) and the result of (c), (d), (e) and (f)

§ 1 .4 ·
0.12 ⋅ 8.85 ⋅ 9.81 ⋅ ¨ 0.48 + ¸
s II IST = © 2.97 ¹
⋅ 5179
1.15 ⋅ 177 + 28.8 − 8.13

s II IST = 228.9 m

(h) Calculation of total distance according to formula 3.1

s IST = 74.51 + 228.9 = 303.4 m

Notes: Given that the term ( RTmII − RG ) as a function of D with 20.67 kN is obviously
relatively small compared with k 3 ⋅ FPOR with 203.55 kN, for simplification purposes, s II
can be taken as proportional to D, i.e. s II = Constant ⋅ D.

4.3 Calculation of sSOLL

Initial values
v STRSOLL = 1.5 m / s = 5.4 km / h DSOLL = DIST = 5179 m 3
ECE/TRANS/SC.3/172/Rev.1
page 216
Appendix 4

vSSOLL = 3.6 m / s = 13 km / h TSOLL = TIST = 2.96 m

vLSOLL = 5.1 m / s = 18.4 km / h

(a) s I SOLL = k1 ⋅ vLSOLL ⋅ t I

s I SOLL = 0.95 ⋅ 5.1 ⋅16 = 77.50 m

DSOLL ⋅ g § vSTRSOLL ·
(b) sIISOLL = k2 ⋅ v 2 II SOLL ⋅ ⋅ ¨ k4 + ¸
k 3 ⋅ FPOR ⋅ RTmII SOLL ⋅ RG ¨ vII SOLL ¸
© ¹
(c) calculation of RTmIISOLL
RT ª kN ⋅ s 2 º
= 10.8 « » as under 4.2, since B, D and T are unchanged.
v2 ¬ m ¼
2

vLSOLL − vSTRSOLL = 3.6 [m / s ]

RTmII SOLL =
RT
v2
( (
⋅ k7 ⋅ k6 ⋅ vLSOLL − vSTRSOLL ))
2
= 10.8 ⋅ (0.55 ⋅ 0.85 ⋅ 3.6 ) = 30.99
2
[kN ]
(d) Resistance to the gradient RG as in 4.2

(e) Calculation of vIISOLL

( )
vII SOLL = k 6 ⋅ vLSOLL − vSTRSOLL = 0.85 ⋅ 3.6 = 3.06 [m/s], v 2 II SOLL = 9.36 [m/s]
2

(f) FPOR as in 4.2.

(g) Calculation of sIISOLL using formula (b) and the result from (c) to (f)
§ 1 .5 ·
0.12 ⋅ 9.36 ⋅ 9.81 ⋅ ¨ 0.48 + ¸
s II SOLL = © 3.06 ¹
⋅ 5179
1.15 ⋅ 177 + 30.99 − 8.13
= 0.0472 ⋅ 5179 = 244.5 m
Constant SOLL

(h) Calculation of total distance

sSOLL = s I SOLL + s II SOLL = 77.5 + 244.5 = 322 m

4.4 Verification that the permissible stopping distance under standard conditions sNORM is
respected
according to formula 2.1 of annex 2

s SOLL 322
s NORM = s MESSLUNG ⋅ = 340 ⋅ = 360.8 m < 550 m
s IST 303.4
 ECE/TRANS/SC.3/172/Rev.1
page 217
Appendix 4

Conclusion:
The permissible limit value is far from being reached, i.e.:
- admission to downstream navigation is possible without problems given the degree
of loading submitted (0.8 ⋅ Dmax ) ,
- a higher degree of loading is possible and may be calculated according to 5 below.
5. Possible increase of DIST in downstream navigation

(s SOLL )Limit
(s NORM )Limit = s MESSUNG ⋅ = 550 m
s IST

s IST 303.4
(s SOLL )Limit = 550 ⋅ = 550 ⋅ = 490.8 m
s MESSUNG 340

Where s II SOLL = Constant SOLL ⋅ D according to the notes under 4.2

(sSOLL )Limit (
= s I SOLL + s II SOLL )Limit
= s I SOLL + 0.0472 ⋅ (DSOLL )Limit

is obtained, hence

(s ) − sI SOLL 490.8 − 77.5

(DSOLL )Limit = I SOLL Limit
= = 8756 m3
0.0472 0.0472
As a result:

Since (DSOLL )Limit > Dmax (8756 > 6474 ) this formation (see 1) may be permitted in
downstream navigation with a full load.

EXAMPLE II
1. Data concerning the vessels and the convoy
Formation: self-propelled vessel-pusher with
2 leading pushed barges and
1 pushed barge coupled abreast

/>P@ %>P@ 7PD[>P@ 7JI PD[>W@ 'PD[>P@ 3%>N:@

6HOISURSHOOHGYHVVHO      

(DFKSXVKHGEDUJH      
&RQYR\      

Propulsion system of the self-propelled vessel: modern nozzles with rounded rear edge.
* Tgf = deadweight
ECE/TRANS/SC.3/172/Rev.1
page 218
Appendix 4

2. Values measured during the stopping manoeuvre

Speed of current vSTRIST = 1.4 m / s ≈ 5.1 km / h 

6SHHGRIYHVVHO UHODWLYHWRWKHZDWHU  vsIST = 3.5 m / s ≈ 12.5 km / h 
6SHHGRIYHVVHO UHODWLYHWRWKHEDQN  vLIST = 4.9 m / s ≈ 17.6 km / h 
'XUDWLRQRIUHYHUVDOPHDVXUHG SRLQW A WR C  t I = 16 sec 
6WRSSLQJGLVWDQFHUHODWLYHWRWKHZDWHU SRLQW A WR D  s MESSUNG = 580 m 
/RDGVLWXDWLRQ SRVVLEO\HVWLPDWHG  DIST = 9568 m3 ≈ 0.8 Dmax 
$FWXDOGUDXJKWRIFRQYR\ TIST = 2.96 ≈ 0.8 Tmax 

3. Limit value according to paragraph 2.1 (a) or (b) of the Administrative Instruction to be
compared with sNORM
Since B > 11.45 and the convoy is in running water, the following applies for this convoy
under 2.1 (a):
s NORM ≤ 550 m

4. Determination of the corrected stopping distance compared with standard conditions

- Measurement: sMESSUNG = 340 m

- calculations to be made:
sIST sum of
sIIST (according to formula 4.1 of annex 2 with VLIST)

and sIIIST (according to formulae 4.2, 4.3, 4.4, 4.5 and 4.6 of annex 2
with real speeds vIST (see under 2 above) and DIST)

s SOLL : sum s I SOLL + s II SOLL (according to formulae 4.1 to 4.6 of annex 2 with standard
speeds and in conformity of annex 2, because the degree of
loading > 70 %,
where DSOL = DIST and TSOLL = TIST )

- to be verified:
sSOLL
s NORM = sMESSUNG ⋅ ≤ 550 m, otherwise
s IST
- calculate:
s * NORM = 550 m by reduction of DIST to D *
 ECE/TRANS/SC.3/172/Rev.1
page 219
Appendix 4

4.1 Coefficients for the calculation of annex 2 in Table 1

for s I IST and s I SOLL k1 = 0.95

for s I IST and s I SOLL k2 = 0.12

k3 = 1.15
k4 = 0.48
k5 = 0.85
k7 = 0.55
From Table 2 (for modern nozzles with rounded rear edge)
f = 0.118

4.2 Calculation of s I IST

(a) s I IST with the values measured during the stopping tests (formula 4.1):
s I IST = k1 ⋅ vLIST ⋅ t I IST
s I IST = 0.95 ⋅ 4.8 ⋅ 16 = 73 m

(b) formula for s II IST

DIST ⋅ g § vSTRIST ·
s II IST = k 2 ⋅ v 2 II IST ⋅ ⋅ ¨ k4 + ¸
k 2 ⋅ FPOR + RTmII IST − RG ¨ vII IST ¸
© ¹

(c) Calculation of RTmII IST according to table 3 and formula 4.3 of annex 2
DIST
1/ 3
= 95681/ 3 = 21.2 [m]
DIST
1/ 3
⋅ (B + 2 ⋅ TIST ) = 21.2 ⋅ (22.8 − 5.92) = 609 m 2 [ ]
RT kN ⋅ s 2
of table 3 = 14 . 0
v2 m2
v LIST − vSTRIST = 4.8 − 1.4 = 3.4 m/s

RTmII IST =
RT
v2
( (
⋅ k7 ⋅ k6 ⋅ vLIST ⋅ vSTRIST ))
2
= 14.0 ⋅ (0.55 ⋅ 0.85 ⋅ 3.4 ) = 35.4
2
[kN]

(d) Calculation of resistance to the gradient RG according to formula 4.4 of annex 2.

RG = 10 -6 ⋅ (0.16 ⋅ D IST ⋅ ρ ⋅ g) = 10 -6 ⋅ (0.16 ⋅ 9568 ⋅ 1000 ⋅ 9.81) = 15.02 [kN]

(e) Calculation of v II IST according to formula 4.5 of annex 2

( )
v II IST = k 6 ⋅ v LIST ⋅ v STRIST = 2.89 [m/s]
2
v II IST = 8.35 [m/s]
ECE/TRANS/SC.3/172/Rev.1
page 220
Appendix 4

(f) Calculation of FPOR according to formula 4.6 and table 2

FPOR = 0.118 ⋅ 1500 = 177 [kN ]
(g) Calculation of s II IST using formula (b) and the result of (c), (d), (e) and (f)
§ 1.4 ·
0.12 ⋅ 8.35 ⋅ 9.81 ¨ 0.48 + ¸
s II IST = © 2.89 ¹
⋅ 9568
1.15 ⋅ 177 + 35.4 − 15.02

(s II IST = 402 [m] )

(h) Calculation of the total distance according to formula 3.1
s IST = 73 + 402 = 475 m

4.3 Calculation of sSOLL

Starting values:
vSTRSOLL = 1.5 m/s ≈ 5.4 km/h DSOLL = DIST = 9568 m 3

vSSOLL = 3.6 m/s ≈ 13 km/h TSOLL = TIST = 2.96 m

v LSOLL = 5.1 m/s ≈ 18.4 km/h

(a) sI SOLL = k1 ⋅ vLSOLL ⋅ t1

sI SOLL = 0.95 ⋅ 5.1 ⋅ 16 = 77.50 m

D SOLL ⋅ g § v STRSOLL ·
(b) s II SOLL = k 2 ⋅ v 2 II SOLL ⋅ ⋅ ¨ k4 + ¸
k 2 ⋅ FPOR + RTmII SOLL ⋅ RG ¨ v II SOLL ¸
© ¹

(c) Calculation of RTmII SOLL

RT ª kN ⋅ s 2 º
= 14.0 « » as under 4.2 since B, D and T and unchanged
v2 ¬ m ¼
2

v LSOLL ⋅ v STRSOLL = 3.6 [m/s]

RTmII SOLL = 14.0 ⋅ (0.55 ⋅ 0.85 ⋅ 3.6 ) = 39.6

2
[kN]

(d) Resistance to the gradient RG as under 4.2

(e) Calculation of vII SOLL

vII SOLL = 0.85 ⋅ 3.6 = 3.06 2
[m/s], v II SOLL = 9.36 [m/s]2
 ECE/TRANS/SC.3/172/Rev.1
page 221
Appendix 4

(f) FPOR as under 4.2

(g) Calculation of sII SOLL using formula (b) and the result of (c) to (f)
§ 1 .5 ·
0.12 ⋅ 9.36 ⋅ 9.81 ⋅ ¨ 0.48 + ¸
s II SOLL = © 3.06 ¹
⋅ 9568
1.15 ⋅ 177 + 39.6 − 15.02

s II SOLL = 0 .04684 ⋅ 9568 = 448 m

Constant SOLL

(h) Calculation to the total distance

s SOLL = s I SOLL + s II SOLL = 77.5 + 448 = 525.5 m

4.4 Verification of observance of the permissible stopping distance under standard conditions
s NORM

according to formula 2.1 of annex 2

sSOLL 525.5
s NORM = s MESSUNG ⋅ = 580 ⋅ = 641 m > 550 m
s IST 475

Conclusion: The limit value has clearly been exceeded; admission to downstream
navigation is possible only with a load restriction. This restricted load may be determined
in conformity with S below.
5. D* permissible in downstream navigation
according to formula 2.1 of annex 2
s * SOLL
s NORM = s MESSUNG ⋅ = 550 m
s IST

Therefore:
sIST
s*SOLL = 550 ⋅ = sI SOLL + s*I SOLL
sMESSUNG

s * SOLL = Constant SOLL ⋅ D* = 0.04684 ⋅ D *

475
550 ⋅ − 77.5
D* = 580 = 7950 [m]
0.04684
Consequence: Since in downstream navigation in the permissible displacement D * is only
7950 m3, the permissible deadweight (zul. Tgf) in this formation is: (by approximation)
ECE/TRANS/SC.3/172/Rev.1
page 222
Appendix 4

zul.Tgf D* 7950
= = = 0.66
max .Tgf Dmax 11960

Permissible deadweight (see 1)

0.66 ⋅ 10700 = 7112 t
 ECE/TRANS/SC.3/172/Rev.1
page 223
Appendix 4

Addendum 4-2

RULES FOR THE CLASSIFICATION AND CONSTRUCTION OF INLAND

NAVIGATION VESSELS OF THE RUSSIAN RIVER REGISTER
15 MANOEUVRABILITY
15.1 APPLICABILITY
15.1.1 This section sets out manoeuvrability requirements for displacement vessels, which
apply to:
.1 Self-propelled cargo vessels that are 40 metres long or more;
.2 Displacement passenger vessels, vessels intended to carry no more than
12 passengers and special-purpose vessels that are 20 metres long or more.
15.1.2 The requirements in this section do not apply to pushed convoys, vessels in
formation, catamarans or vessels with water-jet or cycloidal propellers or paddle wheels.

15.2 DEFINITIONS AND EXPLANATIONS

15.2.1 The terms used in this section should be understood as follows:
.1 Propulsion and steering system — the propeller and its steering devices
(rudders and/or nozzles);
.2 Vessel propulsion and steering system — all the propulsion and steering
systems that are present on the vessel and ensure its longitudinal movement
and manoeuvrability;
.3 Turning capacity — the vessel’s ability to turn within a fairly small radius of
curvature;
.4 Directional stability — the vessel’s ability to maintain the chosen straight
course in deep still water;
.5 Manoeuvrability under wind conditions — the vessel’s ability to:
Maintain any chosen straight course while all propellers are rotating at rated
speed and the wind velocity in the navigational zone does not exceed that
indicated in 15.9.2;
Turn on the spot in the chosen direction under wind conditions by
simultaneously operating the main controls and the bow steering device;
.6 Manoeuvrability with propellers not in operation — the vessel’s ability to
mechanically maintain a straight course under its own momentum, to turn in
the chosen direction and to invert the direction of the turn;
.7 Emergency stopping — quickly changing the operating mode of all the
propellers from full speed ahead to full speed astern in deep still water, when
loaded as indicated in 15.3.2.
ECE/TRANS/SC.3/172/Rev.1
page 224
Appendix 4

15.3 GENERAL INSTRUCTIONS FOR SETTING MANOEUVRABILITY

STANDARDS
15.3.1 A vessel is considered to meet the manoeuvrability requirements set out in this
section if, when loaded in accordance with 15.3.2, it satisfies the following criteria:
.1 Turning capacity (see 15.5);
.2 Directional stability (see 15.6);
.3 Manoeuvrability with propellers not in operation (see 15.7);
.4 Emergency stopping (see 15.8);
.5 Manoeuvrability under wind conditions (see 15.9).
15.3.2 The manoeuvrability test shall be conducted when the vessel is fully loaded, with an
even-keel trim, and fully stocked and refuelled.
Manoeuvrability tests for cargo vessels under wind conditions in accordance with
15.9.2.1 shall be conducted only for vessels in ballast, without cargo, and with 10 % of stock and
fuel.
Manoeuvrability tests for passenger vessels under wind conditions in accordance
with 15.9.2.1 shall be conducted only for vessels without cargo or passengers, and with 10 % of
stock and fuel.
15.3.3 The vessel manoeuvrability criteria set out in this section apply to vessels with the
following types of propulsion and steering systems:
.1 Screw propellers in steering nozzles;
.2 Screw propellers in steering nozzles with a centre rudder;
.3 Rudders behind uncovered screw propellers;
.4 Rudders behind nozzle propellers.
Manoeuvrability criteria values for vessels with the propulsion and steering systems
listed are calculated in accordance with the instructions set out in the “Manual for calculating
manoeuvrability and conducting full-scale manoeuvrability tests on inland and combined
navigation vessels” (hereinafter referred to as the Manual).
15.3.4 Other well-founded methods can be used to determine manoeuvrability criteria for
vessels with the propulsion and steering system types indicated in 15.3.3; the calculation
performed in accordance with the Manual shall be submitted to the River Register at the same
time.
15.3.5 Methods of determining manoeuvrability criteria for vessels with propulsion and
steering system types not indicated in 15.3.3 shall be the subject of special consideration by
the River Register.
15.3.6 Criteria for assessing a vessel’s turning capacity, directional stability and
manoeuvrability with propellers not in operation can also be determined by:
.1 Testing an autonomous self-propelled vessel model which is geometrically
similar to the vessel;
.2 Conducting full-scale tests in accordance with the Manual.
In these cases, criteria values do not have to be calculated.
 ECE/TRANS/SC.3/172/Rev.1
page 225
Appendix 4

15.4 TABLE OF MANOEUVRABILITY CHARACTERISTICS

15.4.1 To facilitate speedy reference, a table of each vessel’s manoeuvrability
characteristics shall be posted in a visible place in the wheelhouse.
15.4.2 The table shall be drawn up by the organization responsible for the design of the
vessel, and the results of the calculations shall be supplemented or corrected on the basis of data
from full-scale tests and tests with self-propelled models.
15.4.3 The form of the table is given in the Manual.

15.5 TURNING CAPACITY

15.5.1 In these Rules, the criterion for measuring turning capacity is the minimum relative
mean steady-turning diameter (Dt/L)min, measured from the centre of gravity, that is, the ratio
between the diameter Dt of the smallest possible turn which the vessel can make in deep still
water and the length L of the vessel at the design waterline DWL, where the speed of rotation of
all the propeller screws is the same prior to the commencement of the manoeuvre and is not
subsequently regulated.
15.5.2 The vessel’s turning capacity is considered to satisfy the requirements set out in the
Rules if the relative steady-turning diameter satisfies the condition
(Dt/L)min ≤2. (15.5.2)

15.6 DIRECTIONAL STABILITY

15.6.1 In these Rules, the criterion for measuring directional stability is the minimum
relative mean steady-turning diameter, measured from the centre of gravity, which the vessel
makes in deep still water with the rudder angle at zero and all propeller screws rotating at the
same speed.
15.6.2 The vessel’s directional stability is considered to satisfy the requirements set out in
the Rules if the steady-turning diameter is 10 or more times the vessel’s length, and also if the
vessel continues to move on a straight course without turning, with the rudder angle at zero.

15.7 MANOEUVRABILITY WITH PROPELLERS NOT IN OPERATION

15.7.1 The criterion for measuring manoeuvrability with propellers not in operation is the
vessel’s capacity to come out of a steady turn, made with the rudder at a 20º angle, after the main
propellers have stopped, without using the steering device.
15.7.2 The vessel is considered to satisfy the requirements set out in the Rules if it can be
taken out of a steady turn, made with the rudder at a 20º angle, after the main propellers have
stopped, by operating the main controls, without using the steering device.

15.8 EMERGENCY STOPPING CAPACITY

15.8.1 The criterion for measuring emergency stopping capacity is the vessel’s stopping
course SAT — the distance, m, which the vessel travels relative to the water from the moment
when the order to make an emergency stop is given to the moment when the vessel has come to a
complete stop relative to the water.
ECE/TRANS/SC.3/172/Rev.1
page 226
Appendix 4

15.8.2 The vessel is considered to satisfy the requirements set out in this section if the
stopping course SAT, m, satisfies the condition
SAT = 30.7 3 V +1.28L, (15.8.2)
Where V is the water displacement of the vessel, m3;
L is the length of the vessel, m.

15.9 MANOEUVRABILITY UNDER WIND CONDITIONS

15.9.1 The criteria for measuring manoeuvrability under wind conditions are:
.1 Wind velocity in navigational zone, m/s, which allows the vessel to move
along any chosen straight course with all propellers rotating at the rated speed;
.2 The specific thrust of the steering device, kN/m2, required for the vessel to turn
on the spot using the main controls and the steering device.
The specific thrust of the steering device of a cargo vessel is the ratio TE/(L·T)
between the thrust of the steering device TE, kN, and the product of the length of the vessel at the
DWL L and the full-load draught T. The specific thrust of the steering device of a passenger
vessel is the ratio TE/S between the thrust of the steering device TE, kN, and the sail area S, m2.
15.9.2 The vessel’s manoeuvrability under wind conditions is considered to satisfy the
requirements set out in 15.9.1.1 if the wind velocity in the navigational zone which still allows
the vessel to move on any chosen straight course with all the propellers rotating at rated speed is:
For “M” and “O” class vessels — no less than 19 m/s;
For “P” and “Ʌ” class vessels — no less than 14 m/s. 27

15.9.3 The requirement set out in 15.9.1.2 shall be met by installing a bow steering device
on the vessel with a specific thrust of no less than the following:
For cargo vessels:
TE (L·T) = 0.03; (15.9.3-1)
For passenger vessels with SL ≥ 20,000 m3
TE/S = 0.04. (15.9.4-2)

15.10 FULL-SCALE TESTS

15.10.1 Full-scale tests designed to determine whether the vessel’s manoeuvrability is in
compliance with the requirements set out in the Rules, as well as additions and corrections to the
table of the vessel’s manoeuvrability characteristics, must be effected together with acceptance
tests:
.1 On the prototypes of series-built vessels;
.2 On individually built vessels;
.3 On vessels that have been repaired, re-equipped or modernized, if this can alter
their manoeuvrability.


27
Chapter 1 of these Recommendations provides that in the Russian Federation, navigational zones 1, 2 and 3
correspond to zones O, P and Ʌ, respectively. Zone M covers waters where wave height can reach 3m.
 ECE/TRANS/SC.3/172/Rev.1
page 227
Appendix 4

15.10.2 Full-scale tests must be carried out in accordance with 15.3.2. Deviations with
regard to draught must not exceed 10 %.
15.10.3 Full-scale manoeuvrability tests on location shall be conducted in deep still water
(the depth of the water in the test area must be no less than three times the draught of the vessel),
with waves no greater than force 1–2 28 and wind velocity no greater than 3–4 m/s.
15.10.4 Full-scale manoeuvrability tests on location shall be conducted using the programme
drawn up on the basis of the instructions set out in the Manual and in the Technical Regulations
for Supervising over the Construction of Vessel and Manufacturing of Materials and Articles
(PTNP).


28
According to the scale of the Central Hydrometeorological Department of the Russian Federation.
ECE/TRANS/SC.3/172/Rev.1
page 228
Appendix 4

Addendum 4-3

RECOMMENDATIONS OF THE DANUBE COMMISSION CONCERNING THE

TECHNICAL AND NAVIGATIONAL CHARACTERISTICS OF PUSHED CONVOYS
I. INTRODUCTION
The present Recommendations, which specify technical and navigational
requirements for pushed convoys, contribute to increasing navigational safety and to creating
favourable conditions for the development of push-towing. They generalize the experience
acquired by the Danube countries in that domain on which the uniform, minimum standards
stemming from the need to ensure navigational safety are based.
II. GENERAL PROVISIONS
2.1 Objectives and scope
The purpose of these Recommendations is to define the technical and navigational
characteristics of pushed convoys.
These Recommendations shall apply on the Danube to all pushed-convoy vessels that
will be built after the entry into force of the Recommendations.
2.2 Terms and definitions
The terms used in these Recommendations are fully in accordance with the terms and
definitions contained in the Basic Provisions relating to Navigation on the Danube (DFND) and
other documents adopted by the Danube Commission.
2.3 Relations with documents in force and the DFND
The provisions of these Recommendations are fully in accordance with the DFND
and the local rules established by the Danube States and special river administrations and with
other documents in force in the domain of push-towing. The provisions of these
Recommendations derive from those of the above-mentioned documents and contribute to their
uniform application.
III. TECHNICAL AND NAVIGATIONAL STANDARDS FOR PUSHED
CONVOYS
The pusher shall always be sufficiently powerful and manoeuvrable to ensure safe
upstream and downstream navigation for the pushed convoy; the technical and navigational
characteristics of the pusher shall not be such as to hinder the movement of other vessels, in
particular when passing through difficult sections (bends, shoals, bridges), and when overtaking,
crossing or stopping.
3.1 Minimum speed
The pusher shall be able to maintain the convoy at a minimum speed of not less than
12 km/h in still water.
This condition is not required for pushers operating only in ports and roads.
 ECE/TRANS/SC.3/172/Rev.1
page 229
Appendix 4

3.2 Stopping distance and stopping time

The pusher shall be sufficiently powerful to bring the pushed convoy to a complete
stop relative to the shore under the following conditions:
The distance travelled before stopping shall not exceed:
• Upstream: 200 m or one convoy length;
• Downstream: 600 m or three convoy lengths.
The stopping time of a convoy shall not exceed:
• Upstream: three minutes;
• Downstream: six minutes.

3.3 Manoeuvrability while going ahead

A pushed convoy shall have good manoeuvrability while going ahead, ensured by the
pusher’s capacity to keep a straight course and to change that course rapidly if necessary. The
time required to put the rudder over from 40° on one side to 35° on the other using the main
steering gear shall not exceed 28 seconds at a maximum speed of travel.
3.3.1 Capacity of the pusher to keep the convoy on a straight course
The time for which the convoy may be held on a straight course without the use of
rudders shall be not less than one minute on average.
The number of course corrections required to keep the convoy on a straight course
for five minutes shall be not more than five.
3.3.2 Capacity of the pusher to change the convoy’s course rapidly
The time required to turn the convoy from a straight course by 10° and return it to the
original straight course by putting the rudder over by ±20° shall not exceed five minutes when
travelling upstream. In the case of evasive action, the distance required across the bed of the
waterway shall not exceed 0.4 convoy lengths.
3.4 Manoeuvrability while going astern
A pushed convoy shall have adequate manoeuvrability while going astern and shall
be capable of moving in the desired direction both when manoeuvring to stop and when
prolonged movement astern is required for navigating reasons.
3.5 Capacity to effect lateral movement
The pusher shall, as far as possible, be capable of moving the convoy laterally, in a
direction perpendicular to its axis, when, in the passage through narrows, shoals or bridges,
during locking, overtaking or manoeuvring in ports or in accident situations, such a movement
becomes necessary.
3.6. Turning time and turning space
The time required to turn a convoy through 180° shall not exceed 10 minutes. The
turning space of the convoy shall not exceed 1.5 convoy lengths across the bed of the waterway,
ECE/TRANS/SC.3/172/Rev.1
page 230
Appendix 4

while drift downstream shall not exceed three convoy lengths. All means of ensuring turning
manoeuvres should be used for this purpose.
METHODS FOR TESTING PUSHED CONVOYS
These methods of conducting tests and measurements to determine the technical and
navigational characteristics of pushed convoys contained in Part III of the outline for the
Recommendations on the subject, are designed to establish uniform principles for full-scale
testing of pushed convoys.
Prior to testing, basic data relating to the pushed convoys and navigating conditions
in the test area need to be determined.
During testing, a minimum of two sets of measurements of the parameters in
question shall be taken, and the average value for each characteristic calculated. The analysis of
the results obtained for each characteristic shall be based on the conclusions of the tests and the
final values for the specific pushed convoy or standard convoy can thus be determined.
A. Basic data on navigating conditions in the test area
Full-scale tests shall be carried out on a straight section of the river where the flow is
uniform and there is sufficient channel width and depth. Testing shall be conducted as far as
possible, in calm weather or with wind speed not exceeding force two on the Beaufort scale.
The bank of the test area shall be equipped with intersection markers and, as far as
possible, with range markers or buoys fitted with radar reflectors. The intersection markers shall
be placed at specified distances from each other.
The characteristics of the navigating conditions at the test area shall include:
• Location of the section (from km … to km …) and its length;
• Date (day, month, year) and time of the test;
• Weather conditions, visibility, wind speed and direction;
• Water level at the nearest measuring post;
• Average speed of current;
• Average channel width;
• Average channel depth.
B. Basic data on pushed convoys
Full-scale tests shall be carried out, as far as possible, with pushed convoys of
maximum size navigating on the sector in question; the maximum dimensions shall be
determined on the basis of practical experience, in the light of navigating conditions and the
power and manoeuvrability of the pusher, while observing the conditions for navigational safety.
On sections where regulations govern the dimensions of pushed convoys, the size of the pushed
convoy shall not exceed the prescribed maximum. The formation of the convoy, the number of
units and the amount of the cargo to be carried should be chosen according to whether the
direction of navigation is upstream or downstream.
Pushed convoy vessels being tested shall as far as possible be of the same type and of
identical draught.
 ECE/TRANS/SC.3/172/Rev.1
page 231
Appendix 4

The characteristics of a pushed convoy are determined by the following:

• Configuration of the pushed convoy;
• Size of the pushed convoy (Lmax, Bmax);
• Displacement, deadweight of the pushed convoy and amount of cargo carried;
• Data on the pushed vessels (Lmax, Bmax, Tmean.eff, Deff, Q);
• Data on the pusher (Lmax, Bmax, Tmax, N).
C. Methods for testing the various technical and navigational characteristics of pushed
convoys
The distance and position of a pushed convoy during testing may be measured by
means of range markers installed on the bank or by radar photography, whereby the images on
the radar screen of the pusher are photographed at specific time intervals, or by any other means
ensuring an accuracy of measurement of ±10 m.
1. Speed
The speed of pushed convoys shall be measured moving both upstream and
downstream, taking the following into account:
(a) Preparation for testing:
• The length of the section to be navigated shall be, as far as possible, not less
than 2 km;
• Before measurements are taken, the pushed convoy shall travel a distance of
one kilometre with the pusher’s engines at full power;
• When the pusher’s rudders are put over during testing, the deflection of the
rudder blade shall not exceed ±5°.
(b) Values to be measured:
• Distance travelled;
• Time required to travel this distance;
• Revolutions of the main machinery.
(c) Data to be calculated:
• Speed of movement upstream relative to the bank;
• Speed of movement upstream relative to the water;
• Speed of movement downstream relative to the bank;
• Speed of movement downstream relative to the water.
The measurements of speed shall be used to determine the minimum speed of a
pushed convoy relative to the bank in km/h which meets the conditions for safety of navigation
even when passing through sections of the channel which are difficult to navigate.
ECE/TRANS/SC.3/172/Rev.1
page 232
Appendix 4

2. Stopping distance and stopping time

These values shall be measured for convoys moving both upstream and downstream.
(a) Preparation for testing:
• Before testing begins, the pushed convoy shall travel a distance of one
kilometre with the pusher’s engines at full power;
• When the pusher’s rudders are put over during testing, the deflection of the
rudder blade shall not exceed ±5°;
(b) Values to be measured:
• Revolutions of the main machinery;
• Speed relative to the bank at the beginning of the tests;
• Time required:
• To stop the engines when going full speed ahead;
• To reverse the engines;
• To put the engines into full speed astern;
• Time required for the engines running at full speed astern to bring the
convoy to a stop relative to the bank;
• Distance travelled relative to the bank, measured in periods of time, before
the convoy is brought to a stop.
(c) Values to be calculated:
• Total distance travelled before stopping relative to the bank when navigating
upstream;
• Total time required to stop the convoy relative to the bank when navigating
upstream;
• Total distance travelled before stopping relative to the bank when navigating
downstream;
• Total time required to stop the convoy relative to the bank when navigating
downstream.

3. Manoeuvrability while going ahead

The evaluation of manoeuvrability while going ahead at full speed (100 % of the
rated power of the main machinery), at medium speed (50 % of the rated power) and at low
speed (25 % of the rated power), when navigating upstream and downstream shall consist in
determining the ability of the pusher to keep the convoy on a straight course with minimum use
of rudders, and its ability to change the convoy’s course rapidly.
 ECE/TRANS/SC.3/172/Rev.1
page 233
Appendix 4

(a) Ability of the pusher to keep the convoy on a straight course

This ability shall be measured at full, medium and low speed upstream and
downstream, and consists in the measurement of the following values:
• Average time that a chosen course can be maintained without the use of
rudders;
• Number of turns of the rudder required to keep the convoy on the course
specified and the average helm value over a period of five minutes.

(b) Ability of the pusher to change the convoy’s course rapidly

This ability shall be measured at full and medium speed upstream, and consists in the
measurement of the following values:
• Time required to turn the convoy from its course by 10° by putting the
rudder
over 20°;
• Time required to return the convoy to its original course and turn it from
that course by 10° in the opposite direction by putting the rudder over 20°
on the opposite side;
• Time required to return the convoy to its original course by putting the
rudder over up to ±20°;
• Distance covered, by periods of time;
• Lateral movement of the convoy from the original straight course.

While navigating downstream, the above measurements shall be taken in the same
way, except that the rudder shall be put over in varying positions of up to 20°, 30° and 40°.
The following may be determined from the measurements:
• The time required to turn the convoy by 10°, to turn it back, to turn it by 10°
to the opposite side and to return the convoy to its original course;
• The distance travelled and the maximum lateral movement of the convoy
while changing course.

4. Manoeuvrability while going astern

Manoeuvrability while going astern, upstream and downstream, shall be ensured by:
• The reverse rudders, or
• The forward and reverse rudders, or
• The rudders and engines.
Measurements of manoeuvrability while going astern are taken in the same way as
those of manoeuvrability while going ahead, keeping in mind the maintenance of the chosen
course and the ability to return to the original course after a turn; the difference between the tests
ECE/TRANS/SC.3/172/Rev.1
page 234
Appendix 4

lies in the fact that for the measurement of the manoeuvrability while going astern, the rudders
may be put over to any position and the engines used.
On the basis of the analysis of the test results, the time for which the pushed convoy
can maintain manoeuvrability while going astern by putting over the rudders and using the
engines shall be determined.
5. Turning time and turning space
Turning ability shall be tested with pushed convoys in formation for upstream and
downstream navigation by the following manoeuvres:
• 180° turn downstream;
• 180° turn upstream.
When turning manoeuvres are effected, any position of the pusher’s rudders, any
speed and any mode of operation of the main machinery as well as the use of the bow rudder are
permitted in order to turn as tightly as possible. The method of effecting this manoeuvre
(position of the rudders, direction of the engines) shall be indicated for each kind of turn, and the
following measurements shall be taken:
• Speed relative to the bank before the tests;
• Time required to turn through 180°;
• Width of turning space, measured perpendicularly to the direction of the
current;
• Length of turning space, measured according to the direction of the current.
On the basis of the analysis of the test results, the following data shall be determined
for the different cases:
• Time required to turn through 180°;
• Ratio of the width of the turning space to the length of the pushed convoy
Bo/L = …;
• Ratio of the length of the turning space to the length of the pushed convoy
Lo/L = … .
 ECE/TRANS/SC.3/172/Rev.1
page 235
Appendix 5

APPENDIX 5

MODEL OF A SERVICE RECORD

-1- A-00735
ECE/TRANS/SC.3/172/Rev.1
page 236
Appendix 5

SERVICE RECORD
issued by:

Holder: ........................................................................................................

Name: ..........................................................................................................

First name(s): ..............................................................................................

Born on: ............................................................................................................. Photograph

of holder
Born at: ........................................................................................................................................

Nationality: ..................................................................................................................................

The holder of this Service Record has given the following proof of identity:

passport
national identity card
the document referred to below, with its official translation:

Description of the document: ...............................................................................

No. of the document: ............................................................................................
Document issued by: ............................................................................................

Place, date, stamp and signature of the authority

issuing the service record

-2- A-00735
 ECE/TRANS/SC.3/172/Rev.1
page 237
Appendix 5

Previous Service Records and address of holder:

The first Service Record bearing the Address of the holder of this Service Record
(insert changes of address here):
No.: ..............................................................
was issued by:
...........................................................................

...........................................................................

...........................................................................

on (date): ......................................................................................................................................

The previous Service Record bearing the Remarks by the authority (for example,
details of a replacement record):

No.: .............................................................. ......................................................................

......................................................................

Date: ............................................................

-3- A-00735
ECE/TRANS/SC.3/172/Rev.1
page 238
Appendix 5

HOLDER’S QUALIFICATIONS IN ACCORDANCE WITH SECTION 23-2

OF CHAPTER 23 “CREWS”

Qualification: ............................................... Qualification: ....................................................

as from (date) as from (date)

Stamp, date and signature of the authority: Stamp, date and signature of the authority:

Qualification: ............................................... Qualification: ....................................................

as from (date) as from (date)

Stamp, date and signature of the authority: Stamp, date and signature of the authority:

Qualification: ............................................... Qualification: ....................................................

as from (date) as from (date)

Stamp, date and signature of the authority: Stamp, date and signature of the authority:

-4- A-00735
 ECE/TRANS/SC.3/172/Rev.1
page 239
Appendix 5

CERTIFICATE OF FITNESS IN ACCORDANCE WITH

SECTION 23-3 OF CHAPTER 23 “CREWS”

The holder of this Service Record qualifies on the basis of the medical certificate referred to in
paragraph 19-3.1 of the above-mentioned chapter

issued by: .....................................................................................................................................

issued on: .....................................................................................................................................

Ƒ fit ...............................................................................................................................

Ƒ limited fitness ............................................................................................................

subject to the following condition(s):

..........................................................................................................................................

..........................................................................................................................................

..........................................................................................................................................

Period of validity: ........................................................................................................................

-5- A-00735
ECE/TRANS/SC.3/172/Rev.1
page 240
Appendix 5

SAILING TIME ON BOARD, NAME OF VESSEL:

Official number of vessel: ...........................................................................................................

Type of vessel: .............................................................................................................................
Flag: .............................................................................................................................................
Length of vessel in m*, number of passengers: ...........................................................................
Owner (name, address): ...............................................................................................................
Entry on duty of holder with the position of: ..............................................................................
Entry on duty on (date): ...............................................................................................................
Until (date): ..................................................................................................................................
Boatmaster (name, address): ........................................................................................................
......................................................................................................................................................
Place, date and signature of boatmaster: ......................................................................................
......................................................................................................................................................
......................................................................................................................................................
Sailing time on board, name of vessel: ........................................................................................
Official number of vessel: ...........................................................................................................
Type of vessel: .............................................................................................................................
Flag: .............................................................................................................................................
Length of vessel in m*, number of passengers: ...........................................................................
Owner (name, address): ...............................................................................................................
......................................................................................................................................................
Entry on duty of holder with the position of: ..............................................................................
Entry on duty on (date): ...............................................................................................................
Until (date): ..................................................................................................................................
Boatmaster (name, address): ........................................................................................................
......................................................................................................................................................
Place, date and signature of boatmaster: ......................................................................................

___________________
* Delete as appropriate

-6- A-00735
 ECE/TRANS/SC.3/172/Rev.1
page 241
Appendix 5

Pages 7–23 are identical to page 6.

-7- A-00735
 SAILING TIMES AND SECTORS COVERED DURING THE YEAR
page 242
Sailing times must correspond to the entries in the log! Appendix 5

Name of vessel Start of End of Number of Signature

Voyage from via to Days
or registration voyage voyage days of of
(k.p.) (k.p.) interrupted
number of vessel (Date) (Date) voyage boatmaster
A B C D E F G
ECE/TRANS/SC.3/172/Rev.1

1
2
3

Entry by the authority: total days of voyage taken into account on this page

- 24 -
Control stamp
Presented on (date) ..........................................................................

Signature and stamp of the authority

Document complete Ƒ yes Ƒ no Ƒ doubts arising from the presentation of the log (extracts)

Ƒ doubts in line(s) ..………………. … Ƒ doubts arising from the presentation of any other appropriate documentary evidence

The headings of columns A to I are not repeated on the next 30 pages.

A-00735
 SAILING TIMES AND SECTORS COVERED DURING THE YEAR: 1995/96
Sailing times must correspond to the entries in the log!

A B C D E F G
1 7000281 Rotterdam Mainz Vienna 22.11.95 11 17.12.95 15 Signature: Huber
2 7000281 Vienna Mainz Basel 20.12.95 4 04.01.96 12 Signature: Huber
3 7000281 Basel Rotterdam 06.01.96 0 10.01.96 5 Signature: Huber
4 7000281 Rotterdam Antwerpen Basel 13.01.96 1 23.01.96 10 Signature: Huber
5 7000281 Basel Antwerpen 25.01.96 0 29.01.96 5 Signature: Huber
6 7000281 Antwerpen Basel 01.02.96 0 07.02.96 7 Signature: Huber
7 7000281 Basel Mainz Bratislava 09.02.96 5 22.02.96 9 Signature: Huber
8 7000281 Bratislava Regensburg 27.02.96 0 02.03.96 5 Signature: Huber
9 7000281 Regensburg Mainz Rotterdam 03.03.96 0 09.03.96 7 Signature: Huber
10 7000281 Rotterdam Basel 12.03.96 0 17.03.96 6 Signature: Huber

- 25 -
Entry by the authority: total days of voyage taken into account on this page 81

Control stamp
Presented on (date) 15.12.1996
page 243
Appendix 5

Signature and stamp of the authority

Document complete Ƒ yes Ƒ no Ƒ doubts arising from the presentation of the log (extracts)
Ƒ doubts in line(s) ………. Ƒ doubts arising from the presentation of any other appropriate documentary evidence
ECE/TRANS/SC.3/172/Rev.1

A-00735
 SAILING TIMES AND SECTORS COVERED DURING THE YEAR
Sailing times must correspond to the entries in the log!
page 244
Appendix 5
A B C D E F G
1
2
3
4
5
ECE/TRANS/SC.3/172/Rev.1

6
7
8
9
10

Entry by the authority: total days of voyage taken into account on this page

- 26 -
Control stamp
Presented on (date) ...........................................................

Signature and stamp of the authority

Document complete Ƒ yes Ƒ no Ƒ doubts arising from the presentation of the log (extracts)
Ƒ doubts in line(s) Ƒ doubts in line(s) of any other appropriate documentary evidence

A-00735
 ECE/TRANS/SC.3/172/Rev.1
page 245
Appendix 5

A-00735
Pages 27–55 are identical to page 26.

- 27 -
ECE/TRANS/SC.3/172/Rev.1
page 246
Appendix 5

Particulars and guidelines concerning the keeping of the Service Record

A. Particulars
The Service Record is an official document within the meaning of section 23-4 of
chapter 23 “Crews”. The entry of incorrect or non-standard particulars may be sanctioned; in
any case it is an offence. The competent authority is responsible for the particulars of a general
nature (pages 2 to 5). The Service Record is valid only when it contains the official entries on
page 2. It is not valid if these official entries are missing.
Who needs a Service Record?
Every crew member must be able to provide proof of his/her qualifications and
fitness by means of a Service Record made out in his/her name. It is also required by persons
wishing to obtain a certificate so that they can provide proof of their sailing times and coverage
of sectors on particular waterways. Crew members who hold a boatmaster’s certificate are not
required to continue to keep a Service Record. The holder of a certificate or any other proof of
proficiency requires a Service Record only for the purpose of recording the sectors covered when
his/her certificate or proof is not valid on those sectors and when he/she wishes to obtain the
relevant document.
What obligations does a Service Record holder have?
The Service Record holder is the person in whose name the Service Record has been
made out.
The Service Record should be given to the boatmaster on the first entry on service
and should be presented to the competent authority at least once every 12 months as from the
date on which it was established for the control stamp.
It is in the holder’s interest to ensure that the particulars entered in the Service
Record by the boatmaster are correct and complete.
It is also in his/her interest to enable the competent authority to check his/her Service
Record more easily by presenting the appropriate documents. If the competent authority
observes that for certain voyages the particulars entered in the Service Record are incomplete or
give rise to doubts which persist once the check has been completed, the voyages in question
cannot be taken into account in calculating sailing time or as providing proof of the sectors
covered.
What are the boatmaster’s obligations?
The boatmaster is required to enter particulars concerning himself/herself in the
Service Record and note on a regular basis sailing times and sectors covered; the boatmaster
must keep the Service Record in a safe place until the end of the service or the term of the labour
contract or any other arrangement. At the holder’s request, the Service Record must be given
back to him/her immediately at any time.
Details of how the Service Record should be kept are given in the instructions below.

− 56 −
 ECE/TRANS/SC.3/172/Rev.1
page 247
Appendix 5

What obligations does the competent authority have?

It is required, but also has the right to check Service Records presented to it and to
stamp them in accordance with its conclusions. It also has the right to request the presentation of
logs, in full or extracts from them, or other appropriate documentary evidence.
B. Instructions concerning the keeping of the Service Record
1. General
1.1 The boatmaster is required to make regular entries in the Service Record.
1.2 Entries concerning the previous voyage shall be made in the Service Record before
the start of the next voyage.
1.3 Entries made in the Service Record shall correspond to those of the log.
1.4 180 days of actual inland waterway voyage are counted as one year’s navigation.
Over a period of 365 consecutive days, a maximum of 180 days may be taken into account.
2. “Sailing time on board” (page 6 and following)
2.1 A new “Sailing time on board, name of vessel” section should be completed when
the holder of the Service Record:
• Begins his/her duties on board
or
• Changes his/her duties on board the same vessel.
2.2 “Entry on duty” indicates the day on which the holder of the Service Record begins
his/her activity on board. “Conclusion of duty” indicates the day on which the holder of the
Service Record ceases his/her activity on board.
3. “Sailing times and sectors covered during the year ...” (page 24 and following)
Do not use page 24, begin on page 26.
3.1 The different voyages shall be entered in order to be taken into account for
calculating sailing times and to provide proof of the sectors covered. The place of departure
shall be entered under B, “Voyage from ...” and the place of destination furthest downstream or
furthest upstream (final destination) shall be entered under “to ...”. The k.p. may be given for
greater accuracy. An entry under “via ...” is not required unless the vessel takes another
waterway or returns from another waterway.
3.2 By derogation from 1.3 and 3.1, a monthly entry for the sectors covered, the number
of voyages made (from the place of departure) and the total sailing period is sufficient in the case
of regular duty on board a vessel over a short distance (e.g. 10 identical successive voyages) or
in the case of shuttle services (e.g. day excursions for the carriage of passengers in local
navigation, worksite traffic).
− 57 −
ECE/TRANS/SC.3/172/Rev.1
page 248
Appendix 5

3.3 Under:
C = “Start of voyage”, the day of departure from the place of departure should be
entered;
D = “Days interrupted”, the number of days during which the voyage has not
continued should be recorded. In the event of a voyage without interruption,
enter “0 (zero)”;
E = “End of voyage”, the day of arrival at the place of destination should be
entered;
F = “Number of days of voyage”, the number of days between “Start of voyage”
(C) and “End of voyage” (E), after deducting “Days interrupted” (D), should
be entered.

3.4 A new line should be begun at each change of vessel.

3.5 Correspondence with the particulars entered in the log (see 1.3) exists if the
particulars for the whole of the voyage from the day and place of departure to the day and place
of arrival match and if the entry “Days interrupted” contains the total number of days on which
the voyage is interrupted (e.g. loading, unloading, waiting) entered in the log.
3.6 On the page “Sailing times and sectors covered”, the competent authority shall
complete the line “Entry by the authority: total days of voyage taken into account on this page”.

− 58 −
 ECE/TRANS/SC.3/172/Rev.1
page 249
Appendix 6

APPENDIX 6
CRITERIA FOR THE APPROVAL OF CLASSIFICATION SOCIETIES
Classification Societies seeking approval shall meet all the following criteria:
1. The Classification Society shall be able to document extensive experience in
assessing the design and construction of inland waterway vessels, including vessels for the
carriage of dangerous goods. The Classification Society shall have comprehensive rules and
regulations for the design, construction and periodic inspection of inland waterway vessels,
including vessels for the carriage of dangerous goods, which shall be published at least in Dutch,
English, French or German and shall be continuously updated and improved through research
and development programmes. The rules and regulations must not conflict with the provisions
of international agreements in force.
2. The Classification Society shall publish its register of vessels annually.
3. The Classification Society shall not be controlled by shipowners or shipbuilders or
by others engaged commercially in the design, manufacture, fitting-out, repair, operation or
insurance of ships. The Classification Society shall not be dependent on a single commercial
enterprise for its revenue.
4. The headquarters of the Classification Society or a branch authorised to give a ruling
and to act in all areas incumbent on it under the regulations governing inland waterway transport
shall be located in one of the UNECE Member States.
5. The Classification Society and its experts shall have a good reputation in inland
waterway transport; the experts shall be able to provide proof of their professional abilities.
They shall act on the responsibility of the Classification Society.
6. The Classification Society shall have a significant technical, managerial, support,
inspection and research staff, in proportion to the tasks and the vessels classified and catering
also for developing capability and updating the regulations. It shall have inspectors in UNECE
Member States.
7. The Classification Society shall be governed by a Code of Ethics.
8. The Classification Society is managed and administered in such a way as to ensure
the confidentiality of information required by a UNECE Member State.
9. The Classification Society is prepared to provide relevant information to a Member
State.
10. The Classification Society’s management has defined and documented its policy and
objectives for, and commitment to, quality and has ensured that this policy is understood,
implemented and maintained at all levels in the Classification Society.
11. The Classification Society shall have prepared and implemented and shall maintain
an effective internal quality system based on the relevant parts of internationally recognized
ECE/TRANS/SC.3/172/Rev.1
page 250
Appendix 6

quality standards and complying with the ISO 9001 and ISO 14001 or EN 45004 (inspection
bodies) and EN 29001 standards. The quality system must be certified by an independent body
of auditors recognized by the administration of the State in which the Classification Society has
its headquarters or branch, as provided for in paragraph 4, and which, inter alia, ensures that:
(a) The Classification Society’s rules and regulations are established and
maintained in a systematic manner;
(b) The Classification Society’s rules and regulations are complied with;
(c) The requirements of the statutory work for which the Classification Society is
authorized are satisfied;
(d) The responsibilities, authorities and interrelation of personnel whose work
affects the quality of the Classification Society’s services are defined and
documented;
(e) All work is carried out under controlled conditions;
(f) a supervisory system is in place which monitors the actions and work carried
out by surveyors and technical and administrative staff employed directly by
the Classification Society;
(g) The requirements of major statutory work for which the Classification Society
organization is authorized are only carried out or directly supervised by its
exclusive surveyors or through exclusive surveyors of other recognized
Classification Societies;
(h) A system for qualification of surveyors and continuous updating of their
knowledge is implemented;
(i) Records are maintained, demonstrating achievement of the required standards
in the items covered by the services performed, as well as the effective
operation of the quality system; and
(j) A comprehensive system of planned and documented internal audits of the
quality related activities in all locations.
12. The quality system must be certified by an independent body of auditors recognized
by the administration of the State in which the Classification Society has its headquarters or
branch, as provided for in section 4.
 ECE/TRANS/SC.3/172/Rev.1
page 251
Appendix 7

APPENDIX 7
REQUIREMENTS CONCERNING LIGHTS AND THE COLOUR OF SIGNAL LIGHTS
ON VESSELS, INTENSITY AND RANGE OF SIGNAL LIGHTS ON VESSELS AND
GENERAL TECHNICAL SPECIFICATIONS APPLICABLE TO RADAR EQUIPMENT

I. Lights and the colour of signal lights on vessels 29

A. General

1. Technical requirements
The construction of and materials of signal lanterns shall be such as to ensure their
safety and durability.
The components of the lantern (for example the cross braces) shall not modify the
intensity, colours or dispersion of the light.
It shall be possible to install the lights on board simply and in the correct position.
It shall be easy to replace the light source.

B. Colour of signal lights

1. A five colour signal system is applied to the lights, and comprises the following
colours:
“white”
“red”
“green”
“yellow” and
“blue”.
This system conforms to the recommendations of the International Commission on
Illumination, “Colours of Signal Lights”, IEC publication No. 2.2 (TC-1.6) 1975.
The colours apply to the light fluxes emitted by the lantern.
2. The colour boundaries of signal lights are demarcated by the coordinates (Table 1) of
the intersecting points of the chromatic diagram of IEC publication No. 2.2 (TC-1.6) 1975
(Figure 1).


29
On the inland waterways of Belarus, Kazakhstan, Lithuania, Republic of Moldova, Russian Federation and
Ukraine the colour of signal lights on vessels shall satisfy the requirements of the competent national authorities.
ECE/TRANS/SC.3/172/Rev.1
page 252
Appendix 7

Table 1
Colour boundaries of signal lights
Colour of
signal light Coordinates of the intersecting points

White x 0.310 0.443 0.500 0.500 0.453 0.310

y 0.283 0.382 0.382 0.440 0.440 0.348

Red x 0.690 0.710 0.680 0.660

y 0.290 0.290 0.320 0.320

Green x 0.009 0.284 0.207 0.013

y 0.720 0.520 0.397 0.494

Yellow x 0.612 0.618 0.575 0.575

y 0.382 0.382 0.425 0.406

Blue x 0.136 0.218 0.185 0.102

y 0.040 0.142 0.175 0.105

 ECE/TRANS/SC.3/172/Rev.1
page 253
Appendix 7

Figure 1
IEC chromaticity diagram

520
530

0.8
510 540

0.7
550

560

0.6

500 570
GREEN

0.5
580
Y
2856 P 2 360
590
2 000
4 000 YELLOW
0.4
600
6 000 1900

610
E
WHITE RED 620
10 000
0.3 630 640
490
X0 650
660
680
690 - 780

0.2

480
BLUE
0.1

470

460
450
440
0 430420 380 - 410
0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8

2360 K corresponds to the light of a vacuum filament lamp.

2848 K corresponds to the light of a gas-filled filament lamp.
ECE/TRANS/SC.3/172/Rev.1
page 254
Appendix 7

II. Intensity and range of signal lights on vessels 30

A. General

1. Signal lights
Signal lights are classified according to their luminous intensity as:
“Ordinary lights”
“Bright lights”
“Strong lights”.

2. Relation between IO, IB and t

IO is the photometric luminous intensity in candela (cd), measured at normal voltage
for electric lights.
IB is the operation luminous intensity in candela (cd).
t is the range in kilometres (km).
Taking into account, for example, the ageing of the light source, the degree of
dirtiness of the optic and variations in the voltage of the on-board grid, IB is 20 % less than IO.
Consequently IB = 0.8 · IO
The relation between IB and t of signal lights is given by the following equation:
IB = 0.2 · t2 · q-t
The atmospheric transmission coefficient q has been taken as 0.76, corresponding to
a meteorological visibility of 14.3 km.

B. Intensity and range 31

1. Luminous intensity and visibility range of signal lights

The following table contains the permitted limits for IO, IB and t according to the
nature of signal lights. The values indicated apply to the light flux emitted by the lantern.
IO and IB are given in cd and t in nautical miles (nm) and kilometres (km).


30
On the inland waterways of Belarus, Kazakhstan, Lithuania, Republic of Moldova, Russian Federation and
Ukraine, the luminous intensity and range of signal lights on vessels shall satisfy the requirements of the competent
national authorities.
31
On certain inland waterways the competent authority may allow the carriage by vessels of signal lights in
accordance with the requirements of the Convention on the International Regulations for Preventing Collisions at
Sea (COLREG).
 ECE/TRANS/SC.3/172/Rev.1
page 255
Appendix 7

Table 2
Minimum and maximum values
Minimum Maximum
Nominal value horizontal horizontal
of visibility Operational photometric photometric
range of signal Minimum value Maximum value of luminous luminous luminous Nature of
lights of visibility range (tmin) visibility range (tmax) intensity (IB ) intensity (IO)* intensity (IO)* signal lights

nm nm km nm km cd cd cd

1 1 1.85 2 3.70 0.9 1.1 5.4 Ordinary

2 2 3.70 5 9.26 4.3 5.4 65 Bright
3 3 5.56 5 9.26 12 15 65 Bright
5 5 9.26 7.5 13.90 52 65** 257 Strong
6 6 11.11 7.5 13.90 94 118** 257 Strong

* To be measured in the laboratory.

** However, for daytime use of the strong yellow scintillating lights a minimum photometric luminous intensity
Io of 900 cd shall apply.

C. Signal light dispersion

1. Horizontal dispersion of intensity

(a) The luminous intensities indicated in section II apply to all directions of the
horizontal plane passing through the focus of the optic or the luminous centre
of gravity of the light source correctly adjusted within the operational sector of
a vertically positioned lantern;
(b) For the masthead lights, stern lights and side lights, the luminous intensities
prescribed shall be maintained throughout the horizontal arc within the sectors
prescribed at least up to within 5° of the limits.
As from 5° within the sectors prescribed up to the limit, the luminous intensity
may decrease by 50 %; it shall subsequently decrease gradually in such a way
that, as from 5° beyond the limits of the sector, only a negligible amount of
light remains;
(c) The side lights shall have the prescribed luminous intensity in the direction
parallel to the axis of the vessel forward. The intensities shall decrease
practically to zero between 1° and 3° beyond the limits of the prescribed
sector;
(d) For bicoloured or tricoloured lanterns, the dispersion of the luminous intensity
shall be uniform so that 3° on either side of the prescribed sector limits, the
maximum permitted intensity is not exceeded and the minimum prescribed
intensity is reached;
(e) The horizontal dispersion of the luminous intensity of the lanterns shall be
uniform throughout the sector, so that the minimum and maximum values
observed do not differ more than by a factor of 1.5 from the photometric
luminous intensity.
ECE/TRANS/SC.3/172/Rev.1
page 256
Appendix 7

2. Vertical dispersion of intensity

In the event of heeling of power driven vessels of up to ± 5° or ± 7.5° from the
horizontal, the luminous intensity shall remain at least equal to 100 % in the first case, and 60 %
in the second case, of the luminous intensity corresponding to 0° heeling, although it shall not
exceed it by more than 1.2 times.
In the event of heeling of sailing vessels of up to ± 5° or ± 25° from the horizontal,
the luminous intensity shall remain at least equal to 100 % in the first case, and 50 % in the
second case, of the luminous intensity corresponding to 0° heeling, although it shall not exceed it
by more than 1.2 times.

III. General technical specifications applicable to radar equipment

1. The technical parameters of radar installations must satisfy the following

requirements:
Minimum range of detection 15 m
Maximum range of detection 32,000 m 32
of shore 60 m high (at height of
installation 10 m)
Distance resolution 15 m at scales 0.5–1.6 km;
1 % of the scale value at other scales
Angular resolution 1.2°
Accuracy of measurement: 10 m for variable range circles;
range 1 % of fixed range circles at scales
0.5–2.0 km; 0.8 % of the value of the
selected scale.
Accuracy of measurement: + 1°
bearings line:
Heading line:
- Width 0.5°
- Deviation 0.5°
Effective diameter of 270 mm 33
screen indicator


32
Maximum range of detection is only required to be ensured for radar equipment installed on vessels operated
on large lakes, reservoirs and in coastal waters.
33
In the Russian Federation effective diameter of screen indicator for vessels with gross tonnage from 300 to
1600 tonnes – not less than 180 mm.
 ECE/TRANS/SC.3/172/Rev.1
page 257
Appendix 7

Range scales 0.5; 1; 1.6; 2; 3.2; 4; 8; 16; 32 km: not

less than 4 fixed range circles within
each scale
Off-centring 1/4–1/3 of the effective diameter of
the image
Bearing facilities:
- Timing Up to 5 seconds
- Error + 1°
Transmission frequency 9.3–9.5 GHz (3.2 cm)
Warm-up time 4 minutes
Minimum antenna speed 24 revolutions per minute

2. The requirements contained in IEC publication 945 “Marine Navigational Equipment

General Requirements” shall apply to power supply, safety, mutual interference of shipborne
equipment, compass safe distance, resistance to climatic influences, mechanical strength,
environmental influences, audible noise emission and equipment markings of radar installations.
Additionally, the requirements of the ITU Radio Regulations shall apply. The equipment shall
satisfy all requirements of these provisions for radar display ambient temperatures between 0 and
- 55 °C in doors and between - 30 and + 55 °C on the open desk.
3. Controls of radar installations
3.1 All controls shall be so arranged that during their operation no information is
concealed from view and radar navigation remains unimpaired.
3.2 Controls which can be used to switch off the equipment or, if activated, could lead to
a malfunction must be protected against accidental operation.
3.3 The following functions must have their own controls with direct access:
(a) Stand-by/on;
(b) Range;
(c) Tuning;
(d) Gain;
(e) Seaclutter (STC);
(f) Rainclutter (FTC);
(g) Variable range marker (VRM);
(h) Cursor or electronic bearing line (EBL) (if fitted);
(i) Ship's heading marker suppression (SHM).
If rotary controls are used for the abovementioned functions, concentric arrangement
of the controls one above the other shall be prohibited.
3.4 At least the controls for gain, sea clutter and rain clutter must be adjustable by means
of a rotary control with an effect proportional to the angle of rotation.
ECE/TRANS/SC.3/172/Rev.1
page 258
Appendix 7

3.5 Adjustment of controls shall be such that movements to the right or upwards have a
positive effect on the variable and movements to the left or downwards a negative effect.
3.6 If push-buttons are used, it shall be possible to locate and operate them by touch.
They shall also have clearly perceptible contact release.
3.7 It must be possible to adjust the brightness of the following variables separately from
zero to the value required for operational purposes:
(a) Radar picture;
(b) Fixed range circles;
(c) Variable range circles;
(d) Bearing scale;
(e) Bearing line;
(f) Rate of turn;
(g) Speed of the vessel;
(h) Rudder position.
(i) Water depth;
(j) Compass course.
3.8 Provided that the difference in brightness of some of the displayed values is only
slight and the fixed range circle, the variable range circle and the bearing line can be switched
off independently of each other, there may be four brightness controls, one for each of the
following groups of values:
(a) Radar picture and lubber line;
(b) Fixed range circles;
(c) Variable range circles;
(d) Bearing line and bearing scale and nautical information
(e) Rate of turn;
(f) Speed of the vessel;
(g) Rudder position;
(h) Water depth;
(i) Compass course.
3.9 The brightness of the lubber line shall be adjustable but shall not be reducible to
zero.
3.10 To switch off the lubber line, there shall be a control with automatic reset.
3.11 From zero, the anti-clutter devices shall be continuously adjustable.
4. Radar picture characteristics
4.1 The diameter of the outer range circle in the range scales specified in paragraph 1
shall be at least 90 % of the effective radar picture diameter.
4.2 The width of the range circles and the variable range marker shall, at the normal
brightness setting, be inferior to 1 % of the effective radar screen but not exceed 1 mm.
4.3 For all range scales, the antenna position shall be visible in the radar picture.
4.4 The display colour shall be chosen on the basis of physiological factors. If various
colours can be reproduced on the screen, the actual radar picture shall be monochrome. The
 ECE/TRANS/SC.3/172/Rev.1
page 259
Appendix 7

reproduction of different colours shall not result in mixed colours, by superimposition, on any
part of the screen.
5. Antenna characteristics and emission spectrum
5.1 The antenna drive system and the antenna shall be such as to allow correct operation
at wind speeds of up to 100 km per hour.
5.2 The antenna drive system shall have a safety switch by means of which the
transmitter and the rotator drive can be switched off.
5.3 The horizontal radiation pattern of the antenna, measured in one direction, shall meet
the following requirements:
(a) - 3 dB, width of the main lobe: maximum 1,2 degrees;
(b) - 20 dB, width of the main lobe: maximum 3,0 degrees;
(c) Side-lobe attenuation within ± 10 degrees around the main lobe: at least -
25 dB;
(d) Side-lobe attenuation outside ± 10 degrees around the main lobe: at least
- 32 dB.
5.4 The vertical radiation pattern of the antenna, measured in one direction, shall meet
the following requirements:
(a) - 3 dB, width of the main lobe: maximum 30 degrees;
(b) The maximum of the main lobe shall be in the horizontal axis;
(c) Side-lobe attenuation: at least - 25 dB.
5.5 The radiated high-frequency energy shall be horizontally polarized.
5.6 The operating frequency of the equipment shall be in a range above 9 GHz which is
allocated under prevailing ITU Radio Regulations to navigational radar equipment.